Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 59 and NADH. Determined by X-ray diffraction at 1.95 Å resolution. Released 17 Jan 2018.
Explore 5W8L in 3D Show helices and sheets RCSB PDB PDBe
5W8L contains 70 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-7 | 5 | |
| β-strand | 21-25 | 5 | 1 |
| α-helix | 29-40 | 12 | |
| β-strand | 46-50 | 5 | 1 |
| α-helix | 54-66 | 13 | |
| α-helix | 68-70 | 3 | |
| β-strand | 75-78 | 4 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 90-93 | 4 | 1 |
| α-helix | 97-100 | 4 | |
| α-helix | 107-126 | 20 | |
| α-helix | 130 | 1 | |
| β-strand | 131-134 | 4 | 1 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 1 |
| α-helix | 163-177 | 15 | |
| α-helix | 181-183 | 3 | |
| β-strand | 184-189 | 6 | 2 |
| β-strand | 190 | 1 | 1 |
| α-helix | 193-195 | 3 | |
| β-strand | 197-205 | 9 | 2 |
| β-strand | 208-209 | 2 | 2 |
| α-helix | 210-213 | 4 | |
| α-helix | 227-244 | 18 | |
| α-helix | 249-263 | 15 | |
| β-strand | 268-275 | 8 | 1 |
| β-strand | 287-295 | 9 | 1 |
| β-strand | 298-302 | 5 | 1 |
| α-helix | 309-326 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-7 | 5 | |
| β-strand | 21-25 | 5 | 3 |
| α-helix | 29-40 | 12 | |
| β-strand | 46-50 | 5 | 3 |
| α-helix | 54-66 | 13 | |
| α-helix | 68-70 | 3 | |
| β-strand | 75-78 | 4 | 3 |
| α-helix | 82-85 | 4 | |
| β-strand | 90-93 | 4 | 3 |
| α-helix | 97-100 | 4 | |
| α-helix | 105-126 | 22 | |
| α-helix | 130 | 1 | |
| β-strand | 131-134 | 4 | 3 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 3 |
| α-helix | 163-177 | 15 | |
| α-helix | 181-183 | 3 | |
| β-strand | 184-185 | 2 | 4 |
| β-strand | 188-189 | 2 | 5 |
| β-strand | 190 | 1 | 3 |
| β-strand | 197-198 | 2 | 5 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-205 | 2 | 4 |
| β-strand | 208-209 | 2 | 4 |
| α-helix | 210-213 | 4 | |
| α-helix | 227-244 | 18 | |
| α-helix | 249-263 | 15 | |
| β-strand | 268-275 | 8 | 3 |
| β-strand | 287-295 | 9 | 3 |
| β-strand | 298-302 | 5 | 3 |
| α-helix | 309-326 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-7 | 5 | |
| β-strand | 21-25 | 5 | 6 |
| α-helix | 29-40 | 12 | |
| β-strand | 46-50 | 5 | 6 |
| α-helix | 54-66 | 13 | |
| α-helix | 68-70 | 3 | |
| β-strand | 75-78 | 4 | 6 |
| α-helix | 82-85 | 4 | |
| β-strand | 90-93 | 4 | 6 |
| α-helix | 97-100 | 4 | |
| α-helix | 105-126 | 22 | |
| α-helix | 130 | 1 | |
| β-strand | 131-134 | 4 | 6 |
| α-helix | 139-150 | 12 | |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 6 |
| α-helix | 163-177 | 15 | |
| α-helix | 181-183 | 3 | |
| β-strand | 184-185 | 2 | 7 |
| β-strand | 188-189 | 2 | 8 |
| β-strand | 190 | 1 | 6 |
| α-helix | 193-195 | 3 | |
| β-strand | 197-198 | 2 | 8 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-205 | 2 | 7 |
| β-strand | 208-209 | 2 | 7 |
| α-helix | 210-213 | 4 | |
| α-helix | 227-244 | 18 | |
| α-helix | 249-263 | 15 | |
| β-strand | 268-275 | 8 | 6 |
| β-strand | 287-295 | 9 | 6 |
| β-strand | 298-302 | 5 | 6 |
| α-helix | 309-326 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| L-lactate dehydrogenase A chain | A, B, C, D | protein | 332 | Homo sapiens | P00338 (AlphaFold model) |
>5W8L_1 L-lactate dehydrogenase A chain (chains A, B, C, D) MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAI | 1,4-dihydronicotinamide adenine dinucleotide | C21 H29 N7 O14 P2 | 4 |
| 9YA | 2-{3-([1,1'-biphenyl]-3-yl)-5-(cyclopropylmethyl)-4-[(4-sulfamoylphenyl)methyl]… | C30 H26 N4 O4 S2 | 4 |
Water and common crystallization additives (EDO) are not listed.
Discovery and Optimization of Potent, Cell-Active Pyrazole-Based Inhibitors of Lactate Dehydrogenase (LDH). Rai, G., Brimacombe, K.R., Mott, B.T. et al. J Med Chem (2017) 60:9184-9204. DOI 10.1021/acs.jmedchem.7b00941 · PubMed
Other PDB entries of the same protein (UniProt P00338 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5W8L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.