5WE0: Shelterin Bridge Assembly
Structural Basis for Shelterin Bridge Assembly. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Dec 2017.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organism
- Schizosaccharomyces pombe (strain 972 / ATCC 24843)
- Chains
- 12
- Atoms
- 9,184
- Mol. weight
- 148.27 kDa
- Ligands
- ZN
- Released
- 20 Dec 2017
Explore 5WE0 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5WE0 contains 63 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-18 | 17 | |
| α-helix | 28-30 | 3 | |
| α-helix | 31-43 | 13 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 54-64 | 11 | |
| α-helix | 93-115 | 23 | |
| α-helix | 130-157 | 28 | |
| α-helix | 164-174 | 11 | |
| α-helix | 179-188 | 10 | |
| α-helix | 193-206 | 14 | |
| α-helix | 209-230 | 22 | |
| α-helix | 238-241 | 4 | |
Chain B: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 480-484 | 5 | |
| α-helix | 490-505 | 16 | |
Chain C: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 473 | 1 | |
| α-helix | 481-483 | 3 | |
Chain D: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-18 | 17 | |
| α-helix | 28-43 | 16 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 54-64 | 11 | |
| α-helix | 93-115 | 23 | |
| α-helix | 130-157 | 28 | |
| α-helix | 164-174 | 11 | |
| α-helix | 179-188 | 10 | |
| α-helix | 193-205 | 13 | |
| α-helix | 209-231 | 23 | |
| α-helix | 238-241 | 4 | |
Chains E and K: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 480-483 | 4 | |
| α-helix | 490-506 | 17 | |
Chains F and L: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 473 | 1 | |
Chain G: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-18 | 17 | |
| α-helix | 28-43 | 16 | |
| α-helix | 45-47 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 54-64 | 11 | |
| α-helix | 93-115 | 23 | |
| α-helix | 130-157 | 28 | |
| α-helix | 164-174 | 11 | |
| α-helix | 182-190 | 9 | |
| α-helix | 193-206 | 14 | |
| α-helix | 209-231 | 23 | |
| α-helix | 238-241 | 4 | |
Chain H: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 480-483 | 4 | |
| α-helix | 490-505 | 16 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protection of telomeres protein poz1 | A, D, G, J | protein | 249 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O13852 (AlphaFold model) |
| Protection of telomeres protein tpz1 | B, E, H, K | protein | 33 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O14246 (AlphaFold model) |
| DNA-binding protein rap1 | C, F, I, L | protein | 30 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | Q96TL7 (AlphaFold model) |
Sequence of entity 1 (A, D, G, J), FASTA
>5WE0_1 Protection of telomeres protein poz1 (chains A, D, G, J)
SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIAF
IEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGLS
KYTNSLLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEK
EMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREI
VKMLTSNIN
Sequence of entity 2 (B, E, H, K), FASTA
>5WE0_2 Protection of telomeres protein tpz1 (chains B, E, H, K)
SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS
Sequence of entity 3 (C, F, I, L), FASTA
>5WE0_3 DNA-binding protein rap1 (chains C, F, I, L)
SDNIFVKPGEDLEIPLLSDYSDSENISEKS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 4 |
Primary citation
Structural Basis for Shelterin Bridge Assembly. Kim, J.K., Liu, J., Hu, X. et al. Mol Cell (2017) 68:698-714.e5. DOI 10.1016/j.molcel.2017.10.032 · PubMed
Other PDB entries of the same protein (UniProt O13852 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5WE2 2.5 Å, Structural Basis for Telomere Length Regulation by the Shelterin Bridge
- 5XXE 2.5 Å, Crystal structure of Poz1 and Tpz1
- 5XXF 3.1 Å, Crystal structure of Poz1, Tpz1 and Rap1
- 5WE1 3.2 Å, Structural Basis for Shelterin Bridge Assembly
Browse structure collections
About this viewer
MolViewer shows 5WE0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.