5WE2: Protection of telomeres protein poz1

Structural Basis for Telomere Length Regulation by the Shelterin Bridge. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 5
Atoms: 4,450
Mol. weight: 70.9 kDa
Ligands: ZN
Released: 20 Dec 2017

Explore 5WE2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WE2 contains 28 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	28-43	16
α-helix	45-49	5
α-helix	51-53	3
α-helix	54-64	11
α-helix	93-114	22
α-helix	130-157	28
α-helix	164-174	11
α-helix	176-178	3
α-helix	179-188	10
α-helix	193-206	14
α-helix	209-230	22
α-helix	238-244	7

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	480-483	4
α-helix	490-504	15

Chain C: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	28-43	16
α-helix	45-49	5
α-helix	54-64	11
α-helix	93-114	22
α-helix	130-157	28
α-helix	164-174	11
α-helix	182-189	8
α-helix	193-206	14
α-helix	209-230	22
α-helix	238-240	3

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	482-484	3
α-helix	490-506	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein poz1	A, C	protein	249	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O13852 (AlphaFold model)
Protection of telomeres protein tpz1	B, D	protein	33	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14246 (AlphaFold model)
DNA-binding protein rap1	F	protein	30	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	Q96TL7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5WE2_1 Protection of telomeres protein poz1 (chains A, C)
SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIAF
IEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGLV
KYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEK
EMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREI
VKMLTSNIN

Sequence of entity 2 (B, D), FASTA

>5WE2_2 Protection of telomeres protein tpz1 (chains B, D)
SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS

Sequence of entity 3 (F), FASTA

>5WE2_3 DNA-binding protein rap1 (chains F)
SDNIFVKPGEDLEIPLLSDYSDSENISEKS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural Basis for Shelterin Bridge Assembly. Kim, J.K., Liu, J., Hu, X. et al. Mol Cell (2017) 68:698-714.e5. DOI 10.1016/j.molcel.2017.10.032 · PubMed

Other PDB entries of the same protein (UniProt O13852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WE0 2.3 Å, Structural Basis for Shelterin Bridge Assembly
5XXE 2.5 Å, Crystal structure of Poz1 and Tpz1
5XXF 3.1 Å, Crystal structure of Poz1, Tpz1 and Rap1
5WE1 3.2 Å, Structural Basis for Shelterin Bridge Assembly

Browse structure collections

About this viewer

MolViewer shows 5WE2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.