5WE1: Shelterin Bridge Assembly

Structural Basis for Shelterin Bridge Assembly. Determined by X-ray diffraction at 3.2 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 4
Atoms: 3,513
Mol. weight: 58.69 kDa
Ligands: ZN
Released: 20 Dec 2017

Explore 5WE1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WE1 contains 24 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	35-42	8
α-helix	45-48	4
α-helix	54-64	11
α-helix	93-113	21
α-helix	131-158	28
α-helix	164-168	5
α-helix	179-187	9
α-helix	188-190	3
α-helix	194-203	10
α-helix	209-229	21

Chains B and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	480-483	4
α-helix	490-506	17

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	32-42	11
α-helix	45-48	4
α-helix	54-64	11
α-helix	93-113	21
α-helix	131-158	28
α-helix	164-173	10
α-helix	182-189	8
α-helix	193-200	8
α-helix	201-204	4
α-helix	209-229	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein poz1,Protection of telomeres protein poz1	A, C	protein	214	Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O13852 (AlphaFold model)
Protection of telomeres protein tpz1	B, D	protein	33	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O14246 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5WE1_1 Protection of telomeres protein poz1,Protection of telomeres protein poz1 (chains A, C)
SESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQGGASQQILWEYSL
ISNALERLENIELERQNCMREDGLSKYTNSLLLNKETLNNEALKLYSCAKAGICRWMAFH
FLEQEPIDHINFTKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSV
LSRYIQCTKLQLEVFCDYDFKQREIVKMLTSNIN

Sequence of entity 2 (B, D), FASTA

>5WE1_2 Protection of telomeres protein tpz1 (chains B, D)
SEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural Basis for Shelterin Bridge Assembly. Kim, J.K., Liu, J., Hu, X. et al. Mol Cell (2017) 68:698-714.e5. DOI 10.1016/j.molcel.2017.10.032 · PubMed

Other PDB entries of the same protein (UniProt O13852 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WE0 2.3 Å, Structural Basis for Shelterin Bridge Assembly
5WE2 2.5 Å, Structural Basis for Telomere Length Regulation by the Shelterin Bridge
5XXE 2.5 Å, Crystal structure of Poz1 and Tpz1
5XXF 3.1 Å, Crystal structure of Poz1, Tpz1 and Rap1

Browse structure collections

About this viewer

MolViewer shows 5WE1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.