5WO3: Chaperone Spy

Name: PDB 5WO3: Chaperone Spy bound to Im7 (Im7 un-modeled)
Published: 2017-08-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Chaperone Spy bound to Im7 (Im7 un-modeled). Determined by X-ray diffraction at 1.87 Å resolution. Released 16 Aug 2017.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,653
Mol. weight: 24.09 kDa
Ligands: ZN
Released: 16 Aug 2017

Explore 5WO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WO3 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	29-32	4
α-helix	36-45	10
α-helix	58-68	11
α-helix	75-83	9
α-helix	86-106	21
α-helix	109-119	11

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	36-47	12
α-helix	59-68	10
α-helix	75-104	30
α-helix	109-121	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Periplasmic chaperone Spy	A, B	protein	97	Escherichia coli	P77754 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WO3_1 Periplasmic chaperone Spy (chains A, B)
SFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEE
QRKANMLALMETQNKIYNILTPEQKKQFNANFEKRLT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	12

Water and common crystallization additives (CL, IMD) are not listed.

Primary citation

Visualizing chaperone-assisted protein folding. Horowitz, S., Salmon, L., Koldewey, P. et al. Nat Struct Mol Biol (2016) 23:691-697. DOI 10.1038/nsmb.3237 · PubMed

Other PDB entries of the same protein (UniProt P77754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WO2 1.77 Å, Chaperone Spy bound to Casein Fragment (Casein un-modeled)
6BIE 1.77 Å, Misreading chaperone-substrate complexes from random noise
5WNW 1.79 Å, Chaperone Spy bound to Im7 6-45 ensemble
5WO1 1.87 Å, Chaperone Spy H96L bound to Im7 L18A L19A L37A (Im7 un-modeled)
6OWZ 2.05 Å, Spy H96L:Im7 L19pI-Phe complex; multiple anomalous datasets contained herein for element…
6OWX 2.06 Å, Spy H96L:Im7 L18pI-Phe complex; multiple anomalous datasets contained herein for element…
6OWY 2.07 Å, Spy H96L:Im7 K20pI-Phe complex; multiple anomalous datasets contained herein for element…

Browse structure collections

About this viewer

MolViewer shows 5WO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.