Spy H96L:Im7 L18pI-Phe complex; multiple anomalous datasets contained herein for element identification. Determined by X-ray diffraction at 2.06 Å resolution. Released 29 May 2019.
Explore 6OWX in 3D Show helices and sheets RCSB PDB PDBe
6OWX contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-48 | 13 | |
| α-helix | 59-68 | 10 | |
| α-helix | 75-84 | 10 | |
| α-helix | 86-104 | 19 | |
| α-helix | 109-120 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 36-48 | 13 | |
| α-helix | 62-68 | 7 | |
| α-helix | 75-104 | 30 | |
| α-helix | 109-120 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Periplasmic chaperone Spy | A, B | protein | 97 | Escherichia coli | P77754 (AlphaFold model) |
>6OWX_1 Periplasmic chaperone Spy (chains A, B) SFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEE QRKANMLALMETQNKIYNILTPEQKKQFNANFEKRLT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 13 |
Water and common crystallization additives (IOD, IMD, CL) are not listed.
Identifying dynamic, partially occupied residues using anomalous scattering. Rocchio, S., Duman, R., El Omari, K. et al. Acta Crystallogr D Struct Biol (2019) 75:1084-1095. DOI 10.1107/S2059798319014475 · PubMed
Other PDB entries of the same protein (UniProt P77754 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6OWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.