6OWZ: Periplasmic chaperone Spy

Name: PDB 6OWZ: Spy H96L:Im7 L19pI-Phe complex; multiple anomalous datasets contained herein for element identification
Published: 2019-05-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Spy H96L:Im7 L19pI-Phe complex; multiple anomalous datasets contained herein for element identification. Determined by X-ray diffraction at 2.05 Å resolution. Released 29 May 2019.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,476
Mol. weight: 24.54 kDa
Ligands: ZN
Released: 29 May 2019

Explore 6OWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OWZ contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	36-45	10
α-helix	58-68	11
α-helix	75-84	10
α-helix	86-105	20
α-helix	109-120	12

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	36-47	12
α-helix	61-68	8
α-helix	75-105	31
α-helix	109-121	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Periplasmic chaperone Spy	A, B	protein	97	Escherichia coli	P77754 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6OWZ_1 Periplasmic chaperone Spy (chains A, B)
SFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEE
QRKANMLALMETQNKIYNILTPEQKKQFNANFEKRLT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	11

Water and common crystallization additives (CL, IMD, IOD) are not listed.

Primary citation

Identifying dynamic, partially occupied residues using anomalous scattering. Rocchio, S., Duman, R., El Omari, K. et al. Acta Crystallogr D Struct Biol (2019) 75:1084-1095. DOI 10.1107/S2059798319014475 · PubMed

Other PDB entries of the same protein (UniProt P77754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WO2 1.77 Å, Chaperone Spy bound to Casein Fragment (Casein un-modeled)
6BIE 1.77 Å, Misreading chaperone-substrate complexes from random noise
5WNW 1.79 Å, Chaperone Spy bound to Im7 6-45 ensemble
5WO1 1.87 Å, Chaperone Spy H96L bound to Im7 L18A L19A L37A (Im7 un-modeled)
5WO3 1.87 Å, Chaperone Spy bound to Im7 (Im7 un-modeled)
6OWX 2.06 Å, Spy H96L:Im7 L18pI-Phe complex; multiple anomalous datasets contained herein for element…
6OWY 2.07 Å, Spy H96L:Im7 K20pI-Phe complex; multiple anomalous datasets contained herein for element…

Browse structure collections

About this viewer

MolViewer shows 6OWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.