5WRL: Mu2 subunit of the clathrin adaptor complex AP2

Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y628 peptide. Determined by X-ray diffraction at 3.1 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,121
Mol. weight: 32.77 kDa
Released: 6 Dec 2017

Explore 5WRL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WRL contains 6 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	218	1	3
β-strand	241	1	3
β-strand	245-248	4	1
β-strand	252	1	2
α-helix	254-257	4
β-strand	263-265	3	2
α-helix	266-268	3
β-strand	270-279	10	1
β-strand	287-294	8	4
β-strand	302-309	8	4
β-strand	316-325	10	1
β-strand	330-337	8	4
β-strand	341-345	5	1
α-helix	346-348	3
β-strand	350-359	10	1
β-strand	363-372	10	4
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain P: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	1
α-helix	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu	A	protein	278	Rattus norvegicus	P84092 (AlphaFold model)
Insulin receptor substrate 1	P	protein	8	Rattus norvegicus	P35570 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5WRL_1 AP-2 complex subunit mu (chains A)
QIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMN
DKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRY
RTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVIC
MKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPS
GLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (P), FASTA

>5WRL_2 Insulin receptor substrate 1 (chains P)
DYMPMSPK

Primary citation

IRS-1 acts as an endocytic regulator of IGF-I receptor to facilitate sustained IGF signaling. Yoneyama, Y., Lanzerstorfer, P., Niwa, H. et al. Elife (2018) 7. DOI 10.7554/eLife.32893 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…

Browse structure collections

About this viewer

MolViewer shows 5WRL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.