5WWP: ORF1ab

Crystal structure of Middle East respiratory syndrome coronavirus helicase (MERS-CoV nsp13). Determined by X-ray diffraction at 3.0 Å resolution. Released 5 Jul 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Human betacoronavirus 2c EMC/2012
Chains: 2
Atoms: 8,571
Mol. weight: 133.55 kDa
Ligands: ZN
Released: 5 Jul 2017

Explore 5WWP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WWP contains 44 α-helices and 74 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	12
β-strand	11-12	2	12
β-strand	14-16	3	13
β-strand	24-25	2	13
α-helix	27-34	8
β-strand	42-43	2	13
β-strand	47	1	13
β-strand	64-66	3	14
β-strand	69-71	3	14
β-strand	81-82	2	14
β-strand	84-85	2	15
β-strand	88-89	2	15
α-helix	103-111	9
β-strand	116	1	16
α-helix	117-122	6
α-helix	128-145	18
α-helix	241-243	3
β-strand	245	1	17
α-helix	263-265	3
α-helix	266-271	6
β-strand	275	1	17
β-strand	277-281	5	18
α-helix	288-298	11
β-strand	304-308	5	18
α-helix	311-324	14
α-helix	327-329	3
β-strand	330-333	4	18
β-strand	347-348	2	18
β-strand	355-359	5	18
β-strand	366-368	3	19
β-strand	370-373	4	18
α-helix	376-378	3
α-helix	381-390	10
β-strand	391-393	3	19
β-strand	396-400	5	18
β-strand	414	1	16
α-helix	419-421	3
α-helix	424-432	9
β-strand	436-437	2	18
β-strand	440-441	2	20
α-helix	446-455	10
β-strand	462-463	2	20
β-strand	471-475	5	21
β-strand	481-482	2	22
β-strand	487-488	2	22
α-helix	490-502	13
α-helix	504-508	5
β-strand	510-513	4	21
α-helix	516-525	10
β-strand	529-532	4	21
α-helix	533-536	4
β-strand	541-547	7	21
α-helix	558-565	8
β-strand	568-576	9	21
α-helix	579-583	5
β-strand	588-589	2	21

Chain B: 23 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	11-12	2	1
β-strand	14-16	3	2
β-strand	24-25	2	2
α-helix	27-35	9
β-strand	42-43	2	2
β-strand	47	1	2
β-strand	64-66	3	3
β-strand	69-71	3	3
β-strand	81-82	2	3
β-strand	84-85	2	4
β-strand	88-89	2	4
α-helix	103-111	9
β-strand	116	1	5
α-helix	117-125	9
α-helix	128-146	19
β-strand	152-159	8	6
β-strand	162-167	6	6
β-strand	182-184	3	6
β-strand	197-202	6	6
β-strand	209-213	5	6
α-helix	217-219	3
β-strand	224-227	4	6
α-helix	241-243	3
β-strand	245	1	7
α-helix	262-265	4
α-helix	266-271	6
β-strand	275	1	7
β-strand	277-281	5	8
α-helix	288-298	11
β-strand	304-308	5	8
α-helix	311-322	12
α-helix	327-329	3
β-strand	330-333	4	8
β-strand	347-348	2	8
β-strand	355-359	5	8
β-strand	366-374	9	8
α-helix	376-378	3
α-helix	381-390	10
β-strand	391-400	10	8
β-strand	414	1	5
α-helix	419-421	3
α-helix	424-431	8
β-strand	436-437	2	8
β-strand	440-441	2	9
α-helix	446-453	8
β-strand	462-463	2	9
β-strand	471-474	4	10
β-strand	481	1	11
β-strand	488	1	11
α-helix	490-501	12
α-helix	505-508	4
β-strand	510-512	3	10
α-helix	516-525	10
β-strand	529-530	2	10
α-helix	534-536	3
β-strand	541-547	7	10
α-helix	553-556	4
α-helix	558-565	8
β-strand	568-575	8	10
α-helix	579-582	4
β-strand	588-589	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF1ab	A, B	protein	600	Human betacoronavirus 2c EMC/2012	K0BWD0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WWP_1 ORF1ab (chains A, B)
GPAVGSCVVCHSQTSLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVS
DVTKLYLGGMSYFCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESG
DYTLANTTTEPLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNR
NYVFTGYHITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAP
TIVNQERYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIY
YPTARVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFS
TINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILYKG
NVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVSRSMLGLTTQTVDSSQG
SEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSFTNYKLQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of Middle East respiratory syndrome coronavirus helicase. Hao, W., Wojdyla, J.A., Zhao, R. et al. PLoS Pathog (2017) 13:e1006474-e1006474. DOI 10.1371/journal.ppat.1006474 · PubMed

Other PDB entries of the same protein (UniProt K0BWD0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YNM 1.68 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAM and m7GpppA
5YNF 1.79 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to m7GpppA
5YNN 1.86 Å, Crystal structure of MERS-CoV nsp16/nsp10complex bound to sinefungin and m7GpppG
5YN6 1.95 Å, Crystal structure of MERS-CoV nsp10/nsp16 complex bound to SAM
5YNQ 1.96 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH and m7GpppG
5YN5 1.96 Å, Crystal structure of MERS-CoV nsp10/nsp16 complex
5YNO 1.96 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH and m7GpppA
5YN8 1.97 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAH
5YNB 1.98 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to Sinefungin
5YNJ 2.04 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to m7GpppG
5YNI 2.07 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to SAM and m7GpppG
5YNP 2.27 Å, Crystal structure of MERS-CoV nsp16/nsp10 complex bound to sinefungin and m7GpppA

Browse structure collections

About this viewer

MolViewer shows 5WWP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.