5WXN: LKB1 and 14-3-3 complex

Structure of the LKB1 and 14-3-3 complex. Determined by X-ray diffraction at 2.93 Å resolution. Released 19 Apr 2017.

Method: X-ray diffraction
Resolution: 2.93 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,670
Mol. weight: 64.36 kDa
Released: 19 Apr 2017

Explore 5WXN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WXN contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	38-68	31
α-helix	73-100	28
α-helix	101-105	5
α-helix	112-132	21
α-helix	135-137	3
α-helix	138-159	22
α-helix	165-181	17
α-helix	185-201	17
α-helix	203-205	3
α-helix	211-228	18

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-68	31
α-helix	73-100	28
α-helix	101-105	5
α-helix	112-130	19
α-helix	138-159	22
α-helix	165-180	16
α-helix	185-200	16
α-helix	203-205	3
α-helix	211-228	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B	protein	267	Homo sapiens	P63104 (AlphaFold model)
Serine/threonine-protein kinase STK11	C, D	protein	13	Homo sapiens	Q15831 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WXN_1 14-3-3 protein zeta/delta (chains A, B)
MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSN
EERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVL
SLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKK
EMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
QLLRDNLTLWTSDTQGDEAEAGEGGEN

Sequence of entity 2 (C, D), FASTA

>5WXN_2 Serine/threonine-protein kinase STK11 (chains C, D)
RWRSMTVVPYLED

Primary citation

Structure of the complex of phosphorylated liver kinase B1 and 14-3-3 zeta. Lu, Y., Ding, S., Zhou, R. et al. Acta Crystallogr F Struct Biol Commun (2017) 73:196-201. DOI 10.1107/S2053230X17003521 · PubMed

Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)

Browse structure collections

About this viewer

MolViewer shows 5WXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.