luciferase with inhibitor 3i. Determined by X-ray diffraction at 3.0 Å resolution. Released 27 Dec 2017.
Explore 5WYS in 3D Show helices and sheets RCSB PDB PDBe
5WYS contains 25 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-9 | 2 | 1 |
| α-helix | 16-17 | 2 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 2 |
| β-strand | 50-52 | 3 | 2 |
| α-helix | 53-70 | 18 | |
| β-strand | 77-82 | 6 | 3 |
| α-helix | 89-98 | 10 | |
| β-strand | 101-106 | 6 | 3 |
| α-helix | 111-121 | 11 | |
| β-strand | 125-128 | 4 | 3 |
| α-helix | 130-132 | 3 | |
| α-helix | 133-140 | 8 | |
| β-strand | 148-151 | 4 | 3 |
| β-strand | 163 | 1 | 3 |
| α-helix | 164-169 | 6 | |
| α-helix | 183-185 | 3 | |
| β-strand | 192-196 | 5 | 3 |
| β-strand | 208-211 | 4 | 3 |
| α-helix | 212-223 | 12 | |
| β-strand | 236-239 | 4 | 2 |
| α-helix | 247-258 | 12 | |
| β-strand | 261-264 | 4 | 2 |
| α-helix | 270-279 | 10 | |
| β-strand | 284-286 | 3 | 2 |
| α-helix | 289-296 | 8 | |
| α-helix | 301-303 | 3 | |
| β-strand | 311-313 | 3 | 2 |
| α-helix | 321-330 | 10 | |
| β-strand | 337 | 1 | 2 |
| β-strand | 339-341 | 3 | 4 |
| α-helix | 343-345 | 3 | |
| β-strand | 348-351 | 4 | 4 |
| α-helix | 352-353 | 2 | |
| β-strand | 363 | 1 | 1 |
| β-strand | 364-365 | 2 | 4 |
| α-helix | 366 | 1 | |
| β-strand | 370-374 | 5 | 1 |
| β-strand | 381 | 1 | 1 |
| β-strand | 388-393 | 6 | 1 |
| β-strand | 400-401 | 2 | 3 |
| α-helix | 405-408 | 4 | |
| β-strand | 409 | 1 | 1 |
| β-strand | 412-413 | 2 | 1 |
| β-strand | 417-426 | 10 | 1 |
| β-strand | 432-435 | 4 | 1 |
| α-helix | 437-439 | 3 | |
| β-strand | 442-445 | 4 | 5 |
| β-strand | 447-449 | 3 | 5 |
| α-helix | 451-460 | 10 | |
| β-strand | 464-474 | 11 | 5 |
| β-strand | 478-487 | 10 | 5 |
| α-helix | 495-502 | 8 | |
| β-strand | 515-518 | 4 | 5 |
| α-helix | 522-523 | 2 | |
| β-strand | 524-525 | 2 | 6 |
| β-strand | 529-530 | 2 | 6 |
| α-helix | 531 | 1 | |
| α-helix | 532-542 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Luciferin 4-monooxygenase | A | protein | 550 | Photinus pyralis | P08659 (AlphaFold model) |
>5WYS_1 Luciferin 4-monooxygenase (chains A) MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMS VRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNI SQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYD FVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPG AVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHS GDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEL PAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI KAKKGGKSKL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7V6 | 5-[(3R)-3-(4-boranylphenyl)-3-oxidanyl-propyl]-2-oxidanyl-benzoic acid | C16 H17 B O4 | 1 |
Inhibiting Firefly Bioluminescence by Chalcones. Zhang, H., Su, J., Lin, Y. et al. Anal Chem (2017) 89:6099-6105. DOI 10.1021/acs.analchem.7b00813 · PubMed
Other PDB entries of the same protein (UniProt P08659 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WYS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.