5XJM: PDB entry 5XJM

Complex structure of angiotensin II type 2 receptor with Fab. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 Jul 2018.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Escherichia coli, Mus musculus
Chains: 4
Atoms: 6,335
Mol. weight: 95.67 kDa
Released: 11 Jul 2018

Explore 5XJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XJM contains 26 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-72	26
α-helix	79-105	27
α-helix	114-147	34
α-helix	155-180	26
β-strand	182-187	6	1
β-strand	192-197	6	1
α-helix	201-203	3
α-helix	204-216	13
α-helix	217-221	5
α-helix	222-1018	39
α-helix	1023-1039	17
α-helix	1061-1079	19
α-helix	1085-1099	15
α-helix	1103-283	42
α-helix	290-318	29

Chain H: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	10-12	3	3
β-strand	17-25	9	2
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-60	3	3
β-strand	68-73	6	2
β-strand	78-84	7	2
α-helix	88-90	3
β-strand	92-97	6	3
β-strand	98	1	4
β-strand	109	1	4
β-strand	114-118	5	3
α-helix	122-123	2
β-strand	124	1	5
β-strand	127-131	5	6
α-helix	141-142	2
β-strand	143-152	10	6
β-strand	153	1	5
β-strand	158-162	5	7
β-strand	169-172	4	6
α-helix	173-175	3
β-strand	176-178	3	6
β-strand	181-190	10	6
β-strand	201-206	6	7
β-strand	211-215	5	7

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	8
β-strand	10-13	4	9
β-strand	19-25	7	8
β-strand	31-37	7	9
β-strand	44-48	5	9
β-strand	52-53	2	9
α-helix	54	1
β-strand	61-66	6	8
β-strand	69-74	6	8
α-helix	79-81	3
β-strand	84-90	7	9
α-helix	95	1
β-strand	96-97	2	9
β-strand	101-105	5	9
α-helix	106	1
β-strand	110	1	10
β-strand	113-117	5	11
α-helix	118-120	3
α-helix	121-126	6
β-strand	128-138	11	11
β-strand	139	1	10
β-strand	143-149	7	12
β-strand	152-154	3	12
β-strand	158-162	5	11
α-helix	163-166	4
β-strand	172-181	10	11
α-helix	182-186	5
β-strand	190-197	8	12
β-strand	204-209	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor	A	protein	422	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P50052 (AlphaFold model)
FabH	H	protein	220	Mus musculus
FabL	L	protein	212	Mus musculus
Sar1, Ile8-angiotensin II	B	protein	8	Homo sapiens	P01019 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XJM_1 Type-2 angiotensin II receptor,Soluble cytochrome b562,Type-2 angiotensin II receptor (chains A)
GCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLL
LATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQ
RRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIAL
MKNILGFIIPLIFIATCYFGIRKHLLKTNADLEDNWETLNDNLKVIEKADNAAQVKDALT
KMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAA
EQLKTTRNAYIQKYLKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSC
EVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESENLY
FQ

Sequence of entity 2 (H), FASTA

>5XJM_2 FabH (chains H)
DVQLVESGGGLVQPGGSRKLSCAASGFTFSGFGMHWVRQAPEKGLEWVAYISSGSSLIYY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYFCATSLYYGTPWFAYWGQGTLVTVSA
AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSG
LYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Sequence of entity 3 (L), FASTA

>5XJM_3 FabL (chains L)
DIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATFYCQQWSSYPLTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Sequence of entity 4 (B), FASTA

>5XJM_4 Sar1, Ile8-angiotensin II (chains B)
GRVYIHPI

Primary citation

Crystal structure of the human angiotensin II type 2 receptor bound to an angiotensin II analog. Asada, H., Horita, S., Hirata, K. et al. Nat Struct Mol Biol (2018) 25:570-576. DOI 10.1038/s41594-018-0079-8 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 5XJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.