5XM2: FACT complex subunit SPT16

Human N-terminal domain of FACT complex subunit SPT16. Determined by X-ray diffraction at 2.19 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 2.19 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,223
Mol. weight: 99.24 kDa
Released: 16 May 2018

Explore 5XM2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XM2 contains 53 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	6-22	17
α-helix	25-27	3
β-strand	32-37	6	1
α-helix	47-56	10
β-strand	63-67	5	1
β-strand	72-76	5	1
α-helix	78-88	11
α-helix	94-96	3
α-helix	100-101	2
β-strand	102-106	5	1
α-helix	114-126	13
β-strand	132-135	4	1
α-helix	144-154	11
β-strand	156	1	2
α-helix	158	1
β-strand	159-162	4	1
α-helix	164-172	9
β-strand	173	1	3
α-helix	174-175	2
α-helix	176-191	16
α-helix	192-197	6
α-helix	198-206	9
β-strand	212	1	4
α-helix	213-223	11
α-helix	227-229	3
α-helix	235-237	3
β-strand	238-240	3	5
β-strand	245-247	3	6
β-strand	258	1	7
β-strand	264	1	4
α-helix	265-266	2
β-strand	269-274	6	6
β-strand	276-278	3	5
β-strand	281-282	2	5
β-strand	285-291	7	6
α-helix	295-314	20
β-strand	320	1	8
α-helix	321-335	15
α-helix	337-339	3
β-strand	343	1	6
β-strand	348-350	3	6
α-helix	358-360	3
β-strand	361	1	6
α-helix	368	1
β-strand	369	1	8
α-helix	370	1
β-strand	374	1	3
β-strand	375-386	12	6
α-helix	393-396	4
β-strand	397-407	11	6
α-helix	414	1
β-strand	415-416	2	6
α-helix	424-427	4
β-strand	428-429	2	6

Chain B: 26 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	6-22	17
α-helix	25-27	3
β-strand	32-37	6	9
α-helix	47-56	10
β-strand	63-67	5	9
β-strand	72-76	5	9
α-helix	78-88	11
α-helix	100-101	2
β-strand	102-106	5	9
α-helix	114-126	13
β-strand	132-135	4	9
α-helix	144-154	11
β-strand	156	1	7
β-strand	159-162	4	9
α-helix	164-172	9
β-strand	173	1	10
α-helix	174-175	2
α-helix	176-191	16
α-helix	192-197	6
α-helix	198-206	9
β-strand	212	1	11
α-helix	213-223	11
α-helix	227-229	3
α-helix	235-237	3
β-strand	238-240	3	12
β-strand	245-247	3	13
β-strand	248	1	14
β-strand	251	1	14
β-strand	258	1	2
β-strand	264	1	11
α-helix	265-266	2
β-strand	269-274	6	13
β-strand	276-278	3	12
β-strand	281-282	2	12
β-strand	285-291	7	13
α-helix	295-314	20
β-strand	320	1	15
α-helix	321-335	15
α-helix	337-339	3
β-strand	343	1	13
β-strand	348-350	3	13
α-helix	358-360	3
β-strand	361	1	13
α-helix	368	1
β-strand	369	1	15
α-helix	370	1
β-strand	374	1	10
β-strand	375-386	12	13
α-helix	393-396	4
β-strand	397-407	11	13
α-helix	414	1
β-strand	415-416	2	13
α-helix	424-427	4
β-strand	428-429	2	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FACT complex subunit SPT16	A, B	protein	437	Homo sapiens	Q9Y5B9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5XM2_1 FACT complex subunit SPT16 (chains A, B)
MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYE
LTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDK
MIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGEL
NLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVE
MCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQE
NYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGS
LVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS
VKKKVKNVGIFLKNEDE

Primary citation

The structural basis of human Spt16 N-terminal domain interaction with histone (H3-H4)2tetramer. Jiang, H., Xu, S., Chen, Y. et al. Biochem Biophys Res Commun (2019) 508:864-870. DOI 10.1016/j.bbrc.2018.11.150 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5B9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E5B 1.84 Å, Crystal structure of Human Spt16 N-terminal domain
5UMU 1.9 Å, Crystal structure of the middle double PH domain of human FACT complex subunit SPT16
4Z2N 1.92 Å, Crystal structure of human FACT SPT16 middle domain
8I17 1.98 Å, Structural basis for H2A-H2B recognitions by human Spt16
5UMT 2.09 Å, Crystal structure of N-terminal domain of human FACT complex subunit SPT16
4Z2M 2.98 Å, Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
9RZC 3.66 Å, State 3 MAP 1 SETD2 bound to distal H3 of upstream nucleosome
8YJM 4.15 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a…
8YJF 4.4 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an…
9GW2 4.84 Å, State 2 MAP 1 SETD2 bound to proximal H3 of upstream nucleosome
6UPK 4.9 Å, Structure of FACT_subnucleosome complex 1

Browse structure collections

About this viewer

MolViewer shows 5XM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.