5XW4: Tyrosine-protein phosphatase CDC14

Crystal structure of budding yeast Cdc14p (wild type) in the apo state. Determined by X-ray diffraction at 1.85 Å resolution. Released 9 Aug 2017.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 6,526
Mol. weight: 95.28 kDa
Released: 9 Aug 2017

Explore 5XW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XW4 contains 40 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
β-strand	18-22	5	1
α-helix	27-29	3
β-strand	33-36	4	1
α-helix	56-71	16
α-helix	73-75	3
β-strand	79-84	6	1
α-helix	88-106	19
α-helix	110-114	5
α-helix	115-117	3
α-helix	123-126	4
β-strand	127	1	2
α-helix	134-135	2
β-strand	139	1	2
α-helix	141-153	13
α-helix	164-170	7
α-helix	173-175	3
β-strand	178-180	3	3
β-strand	185-189	5	3
α-helix	190-191	2
α-helix	209-220	12
β-strand	223-228	6	3
α-helix	237-240	4
β-strand	245-248	4	3
α-helix	259-274	16
β-strand	278-283	6	3
α-helix	288-302	15
α-helix	306-316	11
α-helix	324-342	19
β-strand	343-345	3	4
β-strand	350	1	5
α-helix	351-353	3
β-strand	356	1	5
β-strand	359-361	3	4
α-helix	362-367	6

Chain B: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	6
β-strand	18-22	5	6
α-helix	27-29	3
β-strand	33-36	4	6
α-helix	56-71	16
α-helix	73-75	3
β-strand	79-84	6	6
α-helix	88-105	18
α-helix	110-114	5
α-helix	115-117	3
α-helix	123-126	4
β-strand	127	1	7
α-helix	134-135	2
β-strand	139	1	7
α-helix	141-153	13
α-helix	164-170	7
α-helix	173-175	3
β-strand	178-180	3	8
β-strand	185-189	5	8
α-helix	190-191	2
α-helix	209-220	12
β-strand	223-228	6	8
α-helix	237-240	4
β-strand	245-248	4	8
α-helix	259-274	16
β-strand	278-283	6	8
α-helix	288-302	15
α-helix	306-316	11
α-helix	324-342	19
β-strand	343-345	3	9
α-helix	351-353	3
β-strand	359-361	3	9
α-helix	362-367	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase CDC14	A, B	protein	415	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q00684 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5XW4_1 Tyrosine-protein phosphatase CDC14 (chains A, B)
MGSSHHHHHHSQDPNSSSARLQVDKLDYDIPTTENLYFQGSMRRSVYLDNTIEFLRGRVY
LGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYRFAVIFHEILNDPENANKA
VVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEI
TIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGY
LATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDL
SIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPG
MVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLISLEEYRLQKKKLKD

Primary citation

Structure and dimerization of the catalytic domain of the protein phosphatase Cdc14p, a key regulator of mitotic exit in Saccharomyces cerevisiae. Kobayashi, J., Matsuura, Y. Protein Sci (2017) 26:2105-2112. DOI 10.1002/pro.3244 · PubMed

Other PDB entries of the same protein (UniProt Q00684 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G85 1.53 Å, Structure of Cdc14 bound to CBK1 PxL motif
6G86 1.74 Å, Structure of Cdc14 bound to SIC1 PxL motif
5XW5 1.85 Å, Crystal structure of budding yeast Cdc14p (C283S) bound to a Swi6p phosphopeptide
4ZJ7 2.4 Å, Crystal structure of the karyopherin Kap121p bound to the extreme C-terminus of the…
6G84 2.47 Å, Structure of Cdc14 bound to CBK1 PxL motif

Browse structure collections

About this viewer

MolViewer shows 5XW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.