5XZX: Importin-alpha3

Crystal structure of importin-alpha3 bound to the nuclear localization signal of Ran-binding protein 3. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Aug 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,304
Mol. weight: 48.99 kDa
Released: 9 Aug 2017

Explore 5XZX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XZX contains 32 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	73-79	7
α-helix	85-97	13
α-helix	107-111	5
α-helix	116-122	7
α-helix	129-143	15
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-198	10
α-helix	201-204	4
α-helix	214-229	16
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-272	17
α-helix	274-283	10
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	328-330	3
α-helix	332-335	4
α-helix	340-353	14
α-helix	358-365	8
α-helix	370-379	10
α-helix	382-396	15
α-helix	401-409	9
α-helix	413-417	5
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-463	6
α-helix	471-484	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	48-50	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A	protein	416	Homo sapiens	O00629 (AlphaFold model)
Ran-binding protein 3	B	protein	30	Homo sapiens	Q9H6Z4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XZX_1 Importin subunit alpha-3 (chains A)
NTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNP
SLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGP
QCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCV
LIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVG
NIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANL
VPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQ
VVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF

Sequence of entity 2 (B), FASTA

>5XZX_2 Ran-binding protein 3 (chains B)
GSSPEGGEDSDREDGNYCPPVKRERTSSLT

Primary citation

Crystal structure of importin-alpha 3 bound to the nuclear localization signal of Ran-binding protein 3. Koyama, M., Matsuura, Y. Biochem Biophys Res Commun (2017) 491:609-613. DOI 10.1016/j.bbrc.2017.07.155 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain

Browse structure collections

About this viewer

MolViewer shows 5XZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.