5YIP: AnkG LIR/GABARAPL1 complex

Crystal Structure of AnkG LIR/GABARAPL1 complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 23 May 2018.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 2
Atoms: 1,241
Mol. weight: 17.65 kDa
Released: 23 May 2018

Explore 5YIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YIP contains 7 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-68	12
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1990	1	1
α-helix	1994-2003	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A	protein	123	Mus musculus	Q8R3R8 (AlphaFold model)
Ankyrin-3	B	protein	26	Rattus norvegicus	O70511 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YIP_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A)
GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSD
LTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
YGK

Sequence of entity 2 (B), FASTA

>5YIP_2 Ankyrin-3 (chains B)
PEDDWTEFSSEEIREARQAAASHAPS

Primary citation

Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins. Li, J., Zhu, R., Chen, K. et al. Nat Chem Biol (2018) 14:778-787. DOI 10.1038/s41589-018-0082-8 · PubMed

Other PDB entries of the same protein (UniProt Q8R3R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CDB 1.95 Å, Structure of GABARAPL1 in complex with GABA(A) receptor gamma 2

Browse structure collections

About this viewer

MolViewer shows 5YIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.