Solution structure of the SBDalpha domain of yeast Ssa1. Determined by solution NMR. Released 26 Sept 2018.
Explore 5Z8Q in 3D Show helices and sheets RCSB PDB PDBe
5Z8Q contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-29 | 28 | |
| α-helix | 38-57 | 20 | |
| α-helix | 63-88 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein SSA1 | A | protein | 101 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P10591 (AlphaFold model) |
>5Z8Q_1 Heat shock protein SSA1 (chains A) SKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTT ASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGG
The C-terminal GGAP motif of Hsp70 mediates substrate recognition and stress response in yeast. Gong, W., Hu, W., Xu, L. et al. J Biol Chem (2018) 293:17663-17675. DOI 10.1074/jbc.RA118.002691 · PubMed
Other PDB entries of the same protein (UniProt P10591 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5Z8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.