5ZBZ: DEAD domain of Human eIF4A with sanguinarine

Crystal structure of the DEAD domain of Human eIF4A with sanguinarine. Determined by X-ray diffraction at 1.31 Å resolution. Released 20 Feb 2019.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,896
Mol. weight: 25.36 kDa
Ligands: MLI, SAU
Released: 20 Feb 2019

Explore 5ZBZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZBZ contains 11 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	34-36	3
α-helix	41-50	10
α-helix	57-67	11
β-strand	72-75	4	1
α-helix	82-93	12
β-strand	103-106	4	1
α-helix	110-123	14
β-strand	131-134	4	1
α-helix	137-139	3
α-helix	140-149	10
β-strand	154-157	4	1
α-helix	159-167	9
β-strand	178-182	5	1
α-helix	184-189	6
α-helix	193-202	10
β-strand	208-213	6	1
α-helix	218-227	10
β-strand	232-235	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic initiation factor 4A-I	A	protein	220	Homo sapiens	P60842 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5ZBZ_1 Eukaryotic initiation factor 4A-I (chains A)
GEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQS
GTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGT
NVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYD
IFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKK

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	1
SAU	13-methyl[1,3]benzodioxolo[5,6-c][1,3]dioxolo[4,5-i]phenanthridin-13-ium	C20 H14 N O4	1

Primary citation

Targeting the N Terminus of eIF4AI for Inhibition of Its Catalytic Recycling. Jiang, C., Tang, Y., Ding, L. et al. Cell Chem Biol (2019) 26:1417-1426.e5. DOI 10.1016/j.chembiol.2019.07.010 · PubMed

Other PDB entries of the same protein (UniProt P60842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DTS 1.69 Å, Crystal structure of the human eIF4A1/AMPPNP/amidino-rocaglate/polypurine RNA complex
9I9G 1.7 Å, Crystal structure of human eIF4A1 C-terminal domain in complex with hippuristanol
9AVR 1.91 Å, Human eIF4A-1 in complex with AMP-PNP, RNA, and the inhibitor silvestrol
5ZC9 2.0 Å, Crystal structure of the human eIF4A1-ATP analog-RocA-polypurine RNA complex
2G9N 2.25 Å, Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
7PPZ 2.52 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
9I9F 2.73 Å, Crystal structure of apoform human eIF4A1 C-terminal domain
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
7PQ0 3.0 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
3EIQ 3.5 Å, Crystal structure of Pdcd4-eIF4A
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4

Browse structure collections

About this viewer

MolViewer shows 5ZBZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.