9I9F: Apoform human eIF4A1 C-terminal domain

Name: PDB 9I9F: Crystal structure of apoform human eIF4A1 C-terminal domain
Published: 2026-02-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of apoform human eIF4A1 C-terminal domain. Determined by X-ray diffraction at 2.73 Å resolution. Released 18 Feb 2026.

Method: X-ray diffraction
Resolution: 2.73 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,775
Mol. weight: 59.58 kDa
Released: 18 Feb 2026

Explore 9I9F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I9F contains 29 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	242	1	1
β-strand	246-252	7	2
α-helix	256-258	3
α-helix	259-266	8
α-helix	267-271	5
β-strand	275-278	4	2
α-helix	282-294	13
β-strand	300-301	2	2
α-helix	308-316	9
α-helix	317-321	5
β-strand	325-328	4	2
α-helix	332-335	4
α-helix	338-340	3
β-strand	343-346	4	2
α-helix	353-360	8
β-strand	362	1	1
β-strand	370-376	7	2
α-helix	380-390	11
β-strand	396-397	2	2
α-helix	398	1

Chain B: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	242	1	3
β-strand	247-252	6	4
α-helix	256-258	3
α-helix	259-269	11
β-strand	275-278	4	4
α-helix	282-294	13
β-strand	300-301	2	4
α-helix	308-319	12
β-strand	325-328	4	4
α-helix	330-334	5
α-helix	338-340	3
β-strand	343-346	4	4
α-helix	354-360	7
β-strand	362	1	3
β-strand	371-376	6	4
α-helix	378-390	13
β-strand	396-397	2	4
α-helix	398	1

Chain C: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	242	1	5
β-strand	246-252	7	6
α-helix	256-258	3
α-helix	259-269	11
β-strand	275-278	4	6
α-helix	282-294	13
β-strand	300-301	2	6
α-helix	308-319	12
β-strand	325-328	4	6
α-helix	330-334	5
α-helix	338-340	3
β-strand	343-346	4	6
α-helix	354-360	7
β-strand	362	1	5
β-strand	370-376	7	6
α-helix	378-390	13
β-strand	396-397	2	6
α-helix	398	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic initiation factor 4A-I	A, B, C	protein	170	Homo sapiens	P60842 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9I9F_1 Eukaryotic initiation factor 4A-I (chains A, B, C)
GSEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARD
FTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENY
IHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI

Primary citation

The mechanism of selective eIF4A1-dependent translation. Schmidt, T., Turnbull, A.P., Bushell, M. To be published.

Other PDB entries of the same protein (UniProt P60842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZBZ 1.31 Å, Crystal structure of the DEAD domain of Human eIF4A with sanguinarine
9DTS 1.69 Å, Crystal structure of the human eIF4A1/AMPPNP/amidino-rocaglate/polypurine RNA complex
9I9G 1.7 Å, Crystal structure of human eIF4A1 C-terminal domain in complex with hippuristanol
9AVR 1.91 Å, Human eIF4A-1 in complex with AMP-PNP, RNA, and the inhibitor silvestrol
5ZC9 2.0 Å, Crystal structure of the human eIF4A1-ATP analog-RocA-polypurine RNA complex
2G9N 2.25 Å, Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
7PPZ 2.52 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
2ZU6 2.8 Å, crystal structure of the eIF4A-PDCD4 complex
7PQ0 3.0 Å, Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in…
3EIQ 3.5 Å, Crystal structure of Pdcd4-eIF4A
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4

Browse structure collections

About this viewer

MolViewer shows 9I9F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.