Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA. Determined by X-ray diffraction at 2.6 Å resolution. Released 5 Dec 2018.
Explore 5ZUJ in 3D Show helices and sheets RCSB PDB PDBe
5ZUJ contains 8 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 351-357 | 7 | 1 |
| α-helix | 360-368 | 9 | |
| β-strand | 373-376 | 4 | 2 |
| α-helix | 377-379 | 3 | |
| β-strand | 380-381 | 2 | 2 |
| β-strand | 388-395 | 8 | 2 |
| α-helix | 401-403 | 3 | |
| β-strand | 406-414 | 9 | 2 |
| α-helix | 419-421 | 3 | |
| β-strand | 428-434 | 7 | 1 |
| α-helix | 440-442 | 3 | |
| β-strand | 446-452 | 7 | 1 |
| α-helix | 457-459 | 3 | |
| α-helix | 461-462 | 2 | |
| β-strand | 466 | 1 | 2 |
| β-strand | 469-478 | 10 | 2 |
| α-helix | 481-484 | 4 | |
| β-strand | 489 | 1 | 3 |
| β-strand | 492 | 1 | 3 |
| β-strand | 493-500 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 177-180 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TNF receptor-associated factor 6 | A | protein | 161 | Homo sapiens | Q9Y4K3 (AlphaFold model) |
| peptide 170-184 from TRAF-interacting protein with FHA domain-containing protein A | I | protein | 15 | Homo sapiens | Q96CG3 (AlphaFold model) |
>5ZUJ_1 TNF receptor-associated factor 6 (chains A) MNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYIS LFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNP KGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTLEHHHHHH
>5ZUJ_2 peptide 170-184 from TRAF-interacting protein with FHA domain-containing protein A (chains I) SSQSQSPTEDDENES
Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA. Huang, W.C., Liao, J.H., Hsiao, T.C. et al. Chembiochem (2019) 20:140-146. DOI 10.1002/cbic.201800436 · PubMed
Other PDB entries of the same protein (UniProt Q9Y4K3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ZUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.