Structure of human SLMAP FHA domain. Determined by X-ray diffraction at 1.08 Å resolution. Released 4 Jul 2018.
Explore 6AR0 in 3D Show helices and sheets RCSB PDB PDBe
6AR0 contains 4 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| α-helix | 15-16 | 2 | |
| β-strand | 20-23 | 4 | 1 |
| β-strand | 28-32 | 5 | 2 |
| β-strand | 34 | 1 | 3 |
| β-strand | 37 | 1 | 3 |
| β-strand | 44-46 | 3 | 2 |
| β-strand | 56-61 | 6 | 2 |
| β-strand | 66-71 | 6 | 2 |
| β-strand | 72 | 1 | 4 |
| β-strand | 78-80 | 3 | 1 |
| β-strand | 83-84 | 2 | 1 |
| β-strand | 91 | 1 | 4 |
| α-helix | 92-94 | 3 | |
| β-strand | 95-97 | 3 | 2 |
| β-strand | 99 | 1 | 5 |
| β-strand | 102-105 | 4 | 1 |
| β-strand | 109-110 | 2 | 6 |
| β-strand | 117-118 | 2 | 6 |
| β-strand | 121-128 | 8 | 1 |
| β-strand | 134 | 1 | 1 |
| α-helix | 136 | 1 | |
| β-strand | 137 | 1 | 5 |
| α-helix | 138 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sarcolemmal membrane-associated protein | A | protein | 140 | Homo sapiens | Q14BN4 (AlphaFold model) |
>6AR0_1 Sarcolemmal membrane-associated protein (chains A) MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC IVSTIKLFLPDGMEARLRSD
SAV1 promotes Hippo kinase activation through antagonizing the PP2A phosphatase STRIPAK. Bae, S.J., Ni, L., Osinski, A. et al. Elife (2017) 6. DOI 10.7554/eLife.30278 · PubMed
Other PDB entries of the same protein (UniProt Q14BN4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6AR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.