6AVE: Acid-sensing ion channel 1

Structure of an acid sensing ion channel in a resting state at high pH. Determined by electron microscopy at 3.7 Å resolution. Released 21 Mar 2018.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Gallus gallus
Chains: 3
Atoms: 9,657
Mol. weight: 181.57 kDa
Ligands: NAG
Released: 21 Mar 2018

Explore 6AVE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AVE contains 63 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 21 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	42-69	28
β-strand	74-82	9	1
β-strand	86-87	2	2
α-helix	88-89	2
β-strand	90-95	6	3
α-helix	106-112	7
α-helix	133-142	10
α-helix	155-161	7
β-strand	170-175	6	1
β-strand	178	1	1
α-helix	182-184	3
β-strand	185-189	5	3
β-strand	194-198	5	3
α-helix	205-208	4
β-strand	209-210	2	2
β-strand	219-224	6	1
α-helix	227-229	3
α-helix	231-232	2
β-strand	244	1	4
β-strand	246-251	6	3
α-helix	256-257	2
α-helix	259-262	4
β-strand	264-266	3	3
β-strand	270-282	13	1
α-helix	306-322	17
α-helix	339-340	2
α-helix	341-345	5
α-helix	346-354	9
α-helix	357-359	3
α-helix	363-365	3
β-strand	367-379	13	1
α-helix	386-393	8
α-helix	397-403	7
β-strand	404-411	8	1
β-strand	415-423	9	1
α-helix	427-440	14
α-helix	446-463	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A, B, C	protein	527	Gallus gallus	Q1XA76 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6AVE_1 Acid-sensing ion channel 1 (chains A, B, C)
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
SPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTD
KGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Gating mechanisms of acid-sensing ion channels. Yoder, N., Yoshioka, C., Gouaux, E. Nature (2018) 555:397-401. DOI 10.1038/nature25782 · PubMed

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…

Browse structure collections

About this viewer

MolViewer shows 6AVE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.