6BAT: Wild-Type GltPh

Crystal Structure of Wild-Type GltPh in complex with L-aspartate. Determined by X-ray diffraction at 3.4 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Pyrococcus horikoshii
Chains: 3
Atoms: 9,051
Mol. weight: 133.47 kDa
Ligands: ASP
Released: 17 Jan 2018

Explore 6BAT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BAT contains 69 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 0 β-strands

Element	Residues	Length
α-helix	12-32	21
α-helix	36-42	7
α-helix	44-72	29
α-helix	75-106	32
α-helix	127-129	3
α-helix	130-135	6
α-helix	142-147	6
α-helix	151-169	19
α-helix	175-201	27
α-helix	205-220	16
α-helix	226-242	17
α-helix	243-248	6
α-helix	249-254	6
α-helix	258-264	7
α-helix	266-275	10
α-helix	282-291	10
α-helix	296-309	14
α-helix	312-329	18
α-helix	331-334	4
α-helix	335-351	17
α-helix	358-370	13
α-helix	379-386	8
α-helix	390-415	26

Chain B: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	12-32	21
α-helix	36-42	7
α-helix	44-72	29
α-helix	75-106	32
α-helix	124-129	6
α-helix	130-135	6
α-helix	142-147	6
α-helix	151-169	19
α-helix	175-203	29
α-helix	205-220	16
α-helix	221-223	3
α-helix	227-242	16
α-helix	243-248	6
α-helix	249-253	5
α-helix	258-264	7
α-helix	266-275	10
α-helix	278-291	14
α-helix	296-308	13
α-helix	312-327	16
α-helix	338-351	14
α-helix	358-370	13
α-helix	377-386	10
α-helix	387-389	3
α-helix	390-415	26

Chain C: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	12-32	21
α-helix	36-42	7
α-helix	44-72	29
α-helix	75-106	32
α-helix	126-129	4
α-helix	130-135	6
α-helix	142-147	6
α-helix	151-169	19
α-helix	175-220	46
α-helix	227-242	16
α-helix	243-247	5
α-helix	248-253	6
α-helix	258-264	7
α-helix	266-275	10
α-helix	282-291	10
α-helix	296-306	11
α-helix	312-328	17
α-helix	335-351	17
α-helix	359-363	5
α-helix	365-368	4
α-helix	377-387	11
α-helix	390-415	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate transporter homolog	A, B, C	protein	420	Pyrococcus horikoshii	O59010 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6BAT_1 Glutamate transporter homolog (chains A, B, C)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYADAVKTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPKQAPPLVKILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVKVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKKAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGA
IMLAMVLESVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLV

Ligands and cofactors

ID	Name	Formula	Copies
ASP	Aspartic acid	C4 H7 N O4	3

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural characterisation reveals insights into substrate recognition by the glutamine transporter ASCT2/SLC1A5. Scopelliti, A.J., Font, J., Vandenberg, R.J. et al. Nat Commun (2018) 9:38-38. DOI 10.1038/s41467-017-02444-w · PubMed

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
9BH2 2.7 Å, Apo GltPh, outward-facing state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UGX 2.96 Å, Asp-bound GltPh RSMR mutant in IFS-B1 state
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state

Browse structure collections

About this viewer

MolViewer shows 6BAT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.