6BCU: Activated RHEB-mTORC1 refined to 3.4 angstrom

Cryo-EM structure of the activated RHEB-mTORC1 refined to 3.4 angstrom. Determined by electron microscopy at 3.8 Å resolution. Released 20 Dec 2017.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 10
Atoms: 59,662
Mol. weight: 1016.88 kDa
Ligands: ATP, MG, GTP
Released: 20 Dec 2017

Explore 6BCU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BCU contains 379 α-helices and 204 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 132 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	18-28	11
α-helix	38-52	15
α-helix	61-72	12
α-helix	83-93	11
α-helix	101-111	11
α-helix	122-134	13
α-helix	141-155	15
α-helix	162-178	17
α-helix	180-184	5
α-helix	188-191	4
α-helix	204-221	18
α-helix	233-245	13
α-helix	259-275	17
α-helix	279-287	9
α-helix	362-374	13
α-helix	387-400	14
α-helix	411-423	13
α-helix	430-443	14
α-helix	445-448	4
α-helix	452-462	11
α-helix	480-493	14
α-helix	498-510	13
α-helix	515-527	13
α-helix	529-531	3
α-helix	532-548	17
α-helix	580-591	12
α-helix	599-611	13
α-helix	616-629	14
α-helix	648-665	18
α-helix	669-678	10
α-helix	684-687	4
α-helix	690-699	10
α-helix	705-718	14
α-helix	723-743	21
α-helix	747-763	17
α-helix	765-768	4
α-helix	772-784	13
α-helix	792-809	18
α-helix	817-828	12
α-helix	837-851	15
α-helix	857-860	4
α-helix	864-871	8
α-helix	880-891	12
α-helix	896-902	7
α-helix	936-940	5
α-helix	943-958	16
α-helix	964-982	19
α-helix	985-989	5
α-helix	990-1003	14
α-helix	1006-1023	18
α-helix	1024-1030	7
α-helix	1031-1040	10
α-helix	1046-1063	18
α-helix	1064-1069	6
α-helix	1071-1083	13
α-helix	1088-1090	3
α-helix	1091-1100	10
α-helix	1104-1110	7
α-helix	1111-1123	13
α-helix	1129-1143	15
α-helix	1152-1165	14
α-helix	1167-1169	3
α-helix	1170-1184	15
α-helix	1185-1190	6
α-helix	1192-1199	8
α-helix	1207-1218	12
α-helix	1266-1269	4
α-helix	1277-1294	18
α-helix	1298-1309	12
α-helix	1312-1326	15
α-helix	1331-1346	16
α-helix	1351-1366	16
α-helix	1380-1390	11
α-helix	1393-1404	12
α-helix	1410-1422	13
α-helix	1426-1439	14
α-helix	1447-1453	7
α-helix	1456-1469	14
α-helix	1474-1487	14
α-helix	1491-1498	8
α-helix	1506-1522	17
α-helix	1526-1535	10
α-helix	1541-1554	14
α-helix	1557-1577	21
α-helix	1583-1607	25
α-helix	1613-1625	13
α-helix	1630-1640	11
α-helix	1650-1662	13
α-helix	1666-1677	12
α-helix	1688-1690	3
α-helix	1694-1706	13
α-helix	1710-1729	20
α-helix	1739-1761	23
α-helix	1768-1782	15
α-helix	1787-1812	26
α-helix	1869-1892	24
α-helix	1900-1913	14
α-helix	1917-1929	13
α-helix	1934-1938	5
α-helix	1939-1944	6
α-helix	1951-1966	16
α-helix	1973-1980	8
α-helix	1985-1997	13
α-helix	2003-2020	18
α-helix	2023-2035	13
α-helix	2036-2041	6
α-helix	2045-2058	14
α-helix	2065-2074	10
α-helix	2076-2091	16
α-helix	2094-2112	19
α-helix	2115-2117	3
β-strand	2120-2122	3	1
α-helix	2123-2126	4
α-helix	2128-2132	5
β-strand	2134	1	2
β-strand	2139	1	3
α-helix	2140	1
α-helix	2149-2150	2
β-strand	2152	1	3
β-strand	2153-2156	4	2
β-strand	2159-2162	4	1
β-strand	2170-2171	2	1
β-strand	2173-2176	4	2
β-strand	2181-2183	3	2
β-strand	2184-2187	4	1
α-helix	2193-2211	19
α-helix	2213-2217	5
α-helix	2224-2226	3
β-strand	2227-2229	3	1
β-strand	2235-2238	4	1
β-strand	2243-2245	3	4
α-helix	2246-2256	11
α-helix	2263-2271	9
α-helix	2280-2291	12
α-helix	2297-2305	9
α-helix	2310-2334	25
β-strand	2336	1	5
β-strand	2344-2347	4	4
β-strand	2353-2355	3	4
β-strand	2361	1	5
α-helix	2365-2367	3
α-helix	2381-2385	5
α-helix	2395-2409	15
α-helix	2411-2420	10
α-helix	2429-2432	4
α-helix	2494-2507	14
α-helix	2521-2533	13
α-helix	2535-2540	6
α-helix	2543-2545	3

Chain B: 133 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	18-28	11
α-helix	38-52	15
α-helix	61-72	12
α-helix	83-93	11
α-helix	101-111	11
α-helix	122-134	13
α-helix	141-155	15
α-helix	162-178	17
α-helix	180-184	5
α-helix	188-191	4
α-helix	204-221	18
α-helix	233-245	13
α-helix	259-275	17
α-helix	279-287	9
α-helix	362-374	13
α-helix	387-400	14
α-helix	411-423	13
α-helix	430-443	14
α-helix	445-448	4
α-helix	452-462	11
α-helix	480-493	14
α-helix	498-510	13
α-helix	515-527	13
α-helix	529-531	3
α-helix	532-548	17
α-helix	580-591	12
α-helix	599-611	13
α-helix	616-629	14
α-helix	648-665	18
α-helix	669-678	10
α-helix	684-687	4
α-helix	690-699	10
α-helix	705-718	14
α-helix	723-743	21
α-helix	747-763	17
α-helix	765-768	4
α-helix	769-771	3
α-helix	772-784	13
α-helix	792-809	18
α-helix	817-828	12
α-helix	837-851	15
α-helix	857-860	4
α-helix	864-871	8
α-helix	880-891	12
α-helix	896-902	7
α-helix	936-940	5
α-helix	943-958	16
α-helix	964-982	19
α-helix	985-989	5
α-helix	990-1003	14
α-helix	1006-1023	18
α-helix	1024-1030	7
α-helix	1031-1040	10
α-helix	1046-1063	18
α-helix	1064-1069	6
α-helix	1071-1083	13
α-helix	1088-1090	3
α-helix	1091-1100	10
α-helix	1104-1110	7
α-helix	1111-1123	13
α-helix	1129-1143	15
α-helix	1152-1165	14
α-helix	1167-1169	3
α-helix	1170-1184	15
α-helix	1185-1190	6
α-helix	1192-1199	8
α-helix	1207-1218	12
α-helix	1266-1269	4
α-helix	1277-1294	18
α-helix	1298-1309	12
α-helix	1312-1326	15
α-helix	1331-1346	16
α-helix	1351-1366	16
α-helix	1380-1390	11
α-helix	1393-1404	12
α-helix	1410-1422	13
α-helix	1426-1439	14
α-helix	1447-1453	7
α-helix	1456-1469	14
α-helix	1474-1487	14
α-helix	1491-1498	8
α-helix	1506-1522	17
α-helix	1526-1535	10
α-helix	1541-1554	14
α-helix	1557-1577	21
α-helix	1583-1607	25
α-helix	1613-1625	13
α-helix	1630-1640	11
α-helix	1650-1662	13
α-helix	1666-1677	12
α-helix	1688-1690	3
α-helix	1694-1706	13
α-helix	1710-1729	20
α-helix	1739-1761	23
α-helix	1768-1782	15
α-helix	1787-1812	26
α-helix	1869-1892	24
α-helix	1900-1913	14
α-helix	1917-1929	13
α-helix	1934-1938	5
α-helix	1939-1944	6
α-helix	1951-1966	16
α-helix	1973-1980	8
α-helix	1985-1997	13
α-helix	2003-2020	18
α-helix	2023-2035	13
α-helix	2036-2041	6
α-helix	2045-2058	14
α-helix	2065-2074	10
α-helix	2076-2091	16
α-helix	2094-2112	19
α-helix	2115-2117	3
β-strand	2120-2122	3	30
α-helix	2123-2126	4
α-helix	2128-2132	5
β-strand	2134	1	31
β-strand	2139	1	32
α-helix	2140	1
α-helix	2149-2150	2
β-strand	2152	1	32
β-strand	2153-2156	4	31
β-strand	2159-2162	4	30
β-strand	2170-2171	2	30
β-strand	2173-2176	4	31
β-strand	2181-2183	3	31
β-strand	2184-2187	4	30
α-helix	2193-2211	19
α-helix	2213-2217	5
α-helix	2224-2226	3
β-strand	2227-2229	3	30
β-strand	2235-2238	4	30
β-strand	2243-2245	3	33
α-helix	2246-2256	11
α-helix	2263-2271	9
α-helix	2280-2291	12
α-helix	2297-2305	9
α-helix	2310-2334	25
β-strand	2336	1	34
β-strand	2344-2347	4	33
β-strand	2353-2355	3	33
β-strand	2361	1	34
α-helix	2365-2367	3
α-helix	2381-2385	5
α-helix	2395-2409	15
α-helix	2411-2420	10
α-helix	2429-2432	4
α-helix	2494-2507	14
α-helix	2521-2533	13
α-helix	2535-2540	6
α-helix	2543-2545	3

Chains D and E: 0 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	6
β-strand	23-27	5	6
β-strand	36-39	4	6
β-strand	47-50	4	7
β-strand	56-60	5	7
β-strand	62	1	8
β-strand	65-69	5	7
β-strand	79-81	3	7
β-strand	87	1	8
β-strand	88-90	3	9
β-strand	99-100	2	10
β-strand	103-104	2	9
β-strand	108	1	11
β-strand	112-113	2	10
β-strand	126	1	11
β-strand	131-136	6	12
β-strand	142-147	6	12
β-strand	153-156	4	12
β-strand	162-163	2	12
β-strand	173-178	6	13
β-strand	184-189	6	13
β-strand	193-199	7	13
β-strand	210-216	7	13
β-strand	223-228	6	14
β-strand	234-239	6	14
β-strand	243	1	15
β-strand	244-248	5	14
β-strand	254-256	3	14
β-strand	259	1	15
β-strand	273	1	14
β-strand	276-278	3	16
β-strand	285-287	3	16
β-strand	293-296	4	16
β-strand	306-309	4	16
β-strand	317-322	6	6

Chains R and S: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	58
α-helix	19-27	9
β-strand	41-49	9	58
β-strand	52-60	9	58
α-helix	61-64	4
α-helix	68-71	4
α-helix	74-77	4
β-strand	81-86	6	58
α-helix	91-107	17
β-strand	114-119	6	58
α-helix	131-141	11
β-strand	144-147	4	58
α-helix	153-168	16

Chain W: 50 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	33-36	4
β-strand	59-65	7	17
α-helix	90-92	3
α-helix	95-113	19
β-strand	118-120	3	17
β-strand	123	1	17
β-strand	126	1	18
α-helix	127-141	15
β-strand	146-152	7	17
α-helix	156-159	4
β-strand	163-167	5	18
β-strand	174-178	5	18
α-helix	179-185	7
β-strand	190-195	6	17
α-helix	200-218	19
β-strand	240-244	5	17
α-helix	262-268	7
α-helix	270-280	11
α-helix	282-286	5
α-helix	292-296	5
α-helix	308-327	20
α-helix	330-333	4
α-helix	334-338	5
α-helix	341-358	18
β-strand	365-366	2	17
α-helix	370-372	3
α-helix	378-391	14
α-helix	393-394	2
α-helix	395-399	5
α-helix	401-406	6
α-helix	408-422	15
α-helix	429-430	2
α-helix	433-439	7
α-helix	446-457	12
α-helix	461-469	9
α-helix	473-479	7
α-helix	485-487	3
α-helix	488-501	14
α-helix	503-505	3
α-helix	506-511	6
α-helix	515-523	9
α-helix	529-543	15
α-helix	547-555	9
α-helix	558-565	8
α-helix	571-584	14
α-helix	589-597	9
α-helix	600-604	5
α-helix	605-609	5
α-helix	613-627	15
α-helix	635-648	14
α-helix	649-651	3
α-helix	657-673	17
α-helix	675-684	10
α-helix	807-819	13
α-helix	824-838	15
α-helix	951-953	3
α-helix	959-968	10
α-helix	974-975	2
α-helix	983-1007	25
β-strand	1018-1021	4	19
β-strand	1028-1031	4	20
β-strand	1038-1041	4	20
β-strand	1046-1049	4	20
β-strand	1056-1059	4	20
β-strand	1070	1	21
β-strand	1076	1	22
β-strand	1083	1	22
β-strand	1084-1085	2	23
β-strand	1088	1	21
β-strand	1092-1097	6	23
β-strand	1107-1113	7	23
β-strand	1127-1132	6	24
β-strand	1137-1142	6	24
β-strand	1146-1151	6	24
β-strand	1156-1162	7	24
β-strand	1169	1	25
β-strand	1173-1175	3	26
β-strand	1180-1184	5	26
β-strand	1185	1	25
β-strand	1190-1193	4	26
β-strand	1203-1207	5	26
β-strand	1216	1	27
β-strand	1219	1	27
β-strand	1227-1230	4	27
β-strand	1236-1239	4	27
β-strand	1248-1249	2	27
β-strand	1259-1261	3	28
β-strand	1267-1270	4	28
β-strand	1276-1281	6	28
β-strand	1288-1291	4	28
β-strand	1308-1309	2	19
β-strand	1316-1319	4	19
β-strand	1324-1328	5	19

Chain Y: 50 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	33-36	4
β-strand	59-65	7	46
α-helix	95-113	19
β-strand	118-120	3	46
β-strand	123	1	46
β-strand	126	1	47
α-helix	127-141	15
β-strand	146-152	7	46
α-helix	156-159	4
β-strand	163-167	5	47
β-strand	174-178	5	47
α-helix	179-185	7
β-strand	190-195	6	46
α-helix	200-218	19
β-strand	240-244	5	46
α-helix	262-268	7
α-helix	270-280	11
α-helix	282-286	5
α-helix	292-296	5
α-helix	308-325	18
α-helix	330-333	4
α-helix	334-338	5
α-helix	341-358	18
β-strand	365-366	2	46
α-helix	370-372	3
α-helix	378-391	14
α-helix	393-394	2
α-helix	395-399	5
α-helix	401-406	6
α-helix	408-422	15
α-helix	429-430	2
α-helix	433-439	7
α-helix	446-457	12
α-helix	461-469	9
α-helix	473-478	6
α-helix	479-481	3
α-helix	485-487	3
α-helix	488-501	14
α-helix	503-505	3
α-helix	506-511	6
α-helix	515-523	9
α-helix	529-543	15
α-helix	547-555	9
α-helix	558-565	8
α-helix	571-584	14
α-helix	589-597	9
α-helix	600-604	5
α-helix	605-609	5
α-helix	613-627	15
α-helix	635-648	14
α-helix	649-651	3
α-helix	657-673	17
α-helix	675-684	10
α-helix	807-819	13
α-helix	824-838	15
α-helix	951-953	3
α-helix	959-968	10
α-helix	974-975	2
α-helix	983-1007	25
β-strand	1018-1021	4	48
β-strand	1028-1031	4	49
β-strand	1038-1041	4	49
β-strand	1046-1049	4	49
β-strand	1056-1059	4	49
β-strand	1070	1	50
β-strand	1076	1	51
β-strand	1083	1	51
β-strand	1084-1085	2	52
β-strand	1088	1	50
β-strand	1092-1097	6	52
β-strand	1107-1113	7	52
β-strand	1127-1132	6	53
β-strand	1137-1142	6	53
β-strand	1146-1151	6	53
β-strand	1156-1162	7	53
β-strand	1169	1	54
β-strand	1173-1175	3	55
β-strand	1180-1184	5	55
β-strand	1185	1	54
β-strand	1190-1193	4	55
β-strand	1203-1207	5	55
β-strand	1216	1	56
β-strand	1219	1	56
β-strand	1227-1230	4	56
β-strand	1236-1239	4	56
β-strand	1248-1249	2	56
β-strand	1259-1261	3	57
β-strand	1267-1270	4	57
β-strand	1276-1281	6	57
β-strand	1288-1291	4	57
β-strand	1306-1309	4	48
β-strand	1316-1319	4	48
β-strand	1324-1328	5	48

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase mTOR,Serine/threonine-protein kinase mTOR	A, B	protein	2549	Homo sapiens	P42345 (AlphaFold model)
Target of rapamycin complex subunit LST8	D, E	protein	326	Homo sapiens	Q9BVC4 (AlphaFold model)
Regulatory-associated protein of mTOR,Regulatory-associated protein of mTOR	W, Y	protein	1343	Homo sapiens	Q8N122 (AlphaFold model)
Eukaryotic translation initiation factor 4E-binding protein 1	X, Z	protein	122	Homo sapiens	Q13541 (AlphaFold model)
GTP-binding protein Rheb	R, S	protein	188	Homo sapiens	Q15382

Sequence of entity 1 (A, B), FASTA

>6BCU_1 Serine/threonine-protein kinase mTOR,Serine/threonine-protein kinase mTOR (chains A, B)
MLGTGPAAATTAATTSXXXXXXXXXXXXXXSRNEETXXXXXXXXXXXXXXXXXEMSQEEX
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTXXXXX
XXXXXXXXXXXXXXXXXXXXRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMXKPLRHPGMPKGLAHQLASPGLTTLPEASXVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW

Sequence of entity 2 (D, E), FASTA

>6BCU_2 Target of rapamycin complex subunit LST8 (chains D, E)
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG

Sequence of entity 3 (W, Y), FASTA

>6BCU_3 Regulatory-associated protein of mTOR,Regulatory-associated protein of mTOR (chains W, Y)
MDYKDDDDKESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMK
DRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYEN
WQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYT
QYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMP
LPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTL
DLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLL
AERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQ
LTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGI
FPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHR
TMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSAR
WCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLV
SDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSP
CTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSP
ENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMK
VLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDV
AKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFIS
ATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITR
LDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTA
MEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWE
QETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRV
YDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQI
VKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPH
WPHLAVGSNDYYISVYSVEKRVR

Sequence of entity 4 (X, Z), FASTA

>6BCU_4 Eukaryotic translation initiation factor 4E-binding protein 1 (chains X, Z)
GSGRMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDR
KFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEM
DI

Sequence of entity 5 (R, S), FASTA

>6BCU_5 GTP-binding protein Rheb (chains R, S)
GSGRMPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHL
QLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIML
VGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQ
GKSSCSVM

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	6
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2

Primary citation

Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40. Yang, H., Jiang, X., Li, B. et al. Nature (2017) 552:368-373. DOI 10.1038/nature25023 · PubMed

Other PDB entries of the same protein (UniProt P42345 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DRI 1.45 Å, Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of…
9DBO 1.55 Å, Crystal structure of a synthetic Fab (R3E9) in complex with the FRB domain of mTOR
5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
5WBH 1.75 Å, Structure of the FRB domain of mTOR bound to a substrate recruitment peptide of S6K1
4DRJ 1.8 Å, o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
3FAP 1.85 Å, Atomic structures of the rapamycin analogs in complex with both human FKBP12 and frb…
8PPZ 1.85 Å, Co-crystal structure of FKBP12, compound 7 and the FRB fragment of mTOR
8XI9 1.85 Å, Crystal structure of FRB-FKBP fusion protein in complex with rapamycin
9PIW 1.9 Å, Crystal structure of a synthetic Fab (1A) in complex with the FRB domain of mTOR
9DL0 2.0 Å, Crystal structure of a synthetic Fab (R3H8) in complex with the FRB domain of mTOR
9PJ1 2.05 Å, Crystal structure of a synthetic Fab (4R) in complex with the ternary assembly of…
9PIU 2.18 Å, Crystal structure of a synthetic Fab (2C) in complex with the FRB domain of mTOR

Browse structure collections

About this viewer

MolViewer shows 6BCU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.