Crystal structure of SETDB1 with a modified H3 peptide. Determined by X-ray diffraction at 1.25 Å resolution. Released 6 Dec 2017.
Explore 6BHD in 3D Show helices and sheets RCSB PDB PDBe
6BHD contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 191-192 | 2 | 1 |
| β-strand | 194-195 | 2 | 2 |
| β-strand | 198-199 | 2 | 2 |
| β-strand | 203-207 | 5 | 1 |
| β-strand | 213-224 | 12 | 1 |
| β-strand | 227-234 | 8 | 1 |
| β-strand | 239-242 | 4 | 1 |
| α-helix | 244-246 | 3 | |
| β-strand | 247-249 | 3 | 1 |
| α-helix | 252-254 | 3 | |
| β-strand | 263-269 | 7 | 3 |
| β-strand | 274-283 | 10 | 3 |
| β-strand | 293-297 | 5 | 3 |
| β-strand | 302-305 | 4 | 3 |
| α-helix | 307-309 | 3 | |
| β-strand | 310-312 | 3 | 3 |
| β-strand | 313 | 1 | 1 |
| α-helix | 320-323 | 4 | |
| α-helix | 327-339 | 13 | |
| β-strand | 353-358 | 6 | 4 |
| β-strand | 361-371 | 11 | 4 |
| β-strand | 374-379 | 6 | 4 |
| β-strand | 384-389 | 6 | 4 |
| β-strand | 395 | 1 | 4 |
| α-helix | 396-404 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 4 |
| α-helix | 9-11 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase SETDB1 | A | protein | 239 | Homo sapiens | Q15047 (AlphaFold model) |
| Histone H3.1 | B | protein | 18 | Homo sapiens | P68431 (AlphaFold model) |
>6BHD_1 Histone-lysine N-methyltransferase SETDB1 (chains A) MHHHHHHSSGRENLYFQGGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYK VKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKL RFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSG QLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALE
>6BHD_2 Histone H3.1 (chains B) XKQTARKSTGGKAPRKQX
H3K14ac is linked to methylation of H3K9 by the triple Tudor domain of SETDB1. Jurkowska, R.Z., Qin, S., Kungulovski, G. et al. Nat Commun (2017) 8:2057-2057. DOI 10.1038/s41467-017-02259-9 · PubMed
Other PDB entries of the same protein (UniProt Q15047 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.