6BNW: Unconventional myosin-VI

CryoEM structure of Myosin VI-Actin complex in the ADP state, backbone-averaged with side chains truncated to alanine. Determined by electron microscopy at 5.5 Å resolution. Released 10 Jan 2018.

Method: Electron microscopy
Resolution: 5.5 Å
Organisms: Sus scrofa, Oryctolagus cuniculus
Chains: 14
Atoms: 37,398
Mol. weight: 891.73 kDa
Released: 10 Jan 2018

Explore 6BNW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BNW contains 444 α-helices and 332 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	55
β-strand	17-21	5	55
β-strand	29-31	3	55
β-strand	35-38	4	56
β-strand	41	1	57
β-strand	53-54	2	56
α-helix	57-60	4
β-strand	65-68	4	56
β-strand	71-72	2	58
β-strand	75-76	2	58
α-helix	79-87	9
α-helix	88-94	7
α-helix	98-100	3
β-strand	103-107	5	55
α-helix	115-126	12
β-strand	131-136	6	55
α-helix	137-145	9
β-strand	149-156	8	59
β-strand	159-166	8	59
β-strand	169-170	2	59
α-helix	172-174	3
β-strand	176-178	3	59
α-helix	183-194	12
α-helix	203-215	13
α-helix	223-231	9
β-strand	238-241	4	60
β-strand	247-250	4	60
α-helix	252-259	8
α-helix	272-273	2
α-helix	274-282	9
α-helix	287-293	7
β-strand	297-300	4	59
α-helix	302-305	4
α-helix	311-320	10
α-helix	322	1
β-strand	329-330	2	59
α-helix	335-337	3
α-helix	338-348	11
α-helix	352-355	4
β-strand	357-358	2	55
α-helix	359-365	7

Chains G and H: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	87
β-strand	17-21	5	87
β-strand	29-31	3	87
β-strand	35-38	4	88
β-strand	53-54	2	88
α-helix	57-60	4
β-strand	65-68	4	88
β-strand	71-72	2	89
β-strand	75-76	2	89
α-helix	79-87	9
α-helix	88-94	7
α-helix	98-100	3
β-strand	103-107	5	87
α-helix	115-126	12
β-strand	131-136	6	87
α-helix	137-145	9
β-strand	149-156	8	79
β-strand	159-166	8	79
β-strand	169-170	2	79
α-helix	172-174	3
β-strand	176-178	3	79
α-helix	183-194	12
α-helix	203-215	13
α-helix	223-231	9
β-strand	238-241	4	90
β-strand	247-250	4	90
α-helix	252-259	8
α-helix	272-273	2
α-helix	274-282	9
α-helix	287-293	7
β-strand	297-300	4	79
α-helix	302-305	4
α-helix	311-320	10
α-helix	322	1
β-strand	329-330	2	79
α-helix	335-337	3
α-helix	338-348	11
α-helix	352-355	4
β-strand	357-358	2	87
α-helix	359-365	7

Chains I, K, L and M: 46 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-23	9	1
β-strand	29-33	5	1
β-strand	41-43	3	1
α-helix	45-47	3
β-strand	49-50	2	1
β-strand	61	1	2
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	2
β-strand	93-97	5	2
α-helix	102-103	2
α-helix	109-115	7
α-helix	118-119	2
β-strand	120	1	3
β-strand	123	1	3
α-helix	128-140	13
β-strand	145-150	6	2
α-helix	159-168	10
α-helix	180-193	14
β-strand	194-195	2	4
β-strand	203-204	2	4
β-strand	207-213	7	2
β-strand	222-228	7	2
α-helix	233-236	4
α-helix	248-252	5
α-helix	257-260	4
α-helix	268-270	3
β-strand	282	1	5
α-helix	285-290	6
α-helix	293-295	3
α-helix	298-303	6
α-helix	305	1
β-strand	306	1	5
α-helix	307	1
α-helix	313-326	14
α-helix	331-347	17
β-strand	352-355	4	6
β-strand	361-364	4	6
α-helix	366-368	3
α-helix	370-379	10
α-helix	383-390	8
β-strand	392-396	5	7
β-strand	406-410	5	7
α-helix	411-412	2
α-helix	413-440	28
β-strand	451-456	6	2
α-helix	468-484	17
α-helix	485-489	5
α-helix	490-496	7
α-helix	512-518	7
α-helix	526-534	9
α-helix	540-550	11
β-strand	557-558	2	8
α-helix	560-562	3
α-helix	566-569	4
α-helix	573-575	3
β-strand	576-581	6	8
β-strand	584-589	6	8
α-helix	593-596	4
α-helix	603-609	7
α-helix	615-620	6
α-helix	644-659	16
β-strand	662-669	8	2
α-helix	684-690	7
α-helix	694-700	7
β-strand	707-710	4	9
α-helix	711-718	8
α-helix	719-721	3
α-helix	726-728	3
α-helix	731-742	12
β-strand	749-751	3	9
β-strand	755-758	4	9
α-helix	763-770	8
α-helix	774-790	17

Chains J and N: 46 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	10
β-strand	15-23	9	10
β-strand	29-33	5	10
β-strand	41-43	3	10
α-helix	45-47	3
β-strand	49-50	2	10
β-strand	61	1	11
α-helix	62-64	3
α-helix	70-82	13
β-strand	87-90	4	11
β-strand	93-97	5	11
α-helix	102-103	2
α-helix	109-115	7
α-helix	118-119	2
β-strand	120	1	12
β-strand	123	1	12
α-helix	128-140	13
β-strand	145-150	6	11
α-helix	159-168	10
α-helix	181-193	13
β-strand	194-195	2	13
β-strand	203-204	2	13
β-strand	207-213	7	11
β-strand	222-228	7	11
α-helix	233-236	4
α-helix	248-252	5
α-helix	257-260	4
α-helix	268-270	3
β-strand	282	1	14
α-helix	285-290	6
α-helix	293-295	3
α-helix	298-303	6
α-helix	305	1
β-strand	306	1	14
α-helix	307	1
α-helix	313-326	14
α-helix	331-347	17
β-strand	352-355	4	15
β-strand	361-364	4	15
α-helix	366-368	3
α-helix	370-379	10
α-helix	383-390	8
β-strand	392-396	5	16
β-strand	406-410	5	16
α-helix	411-412	2
α-helix	413-440	28
β-strand	451-456	6	11
α-helix	468-484	17
α-helix	485-489	5
α-helix	490-496	7
α-helix	512-518	7
α-helix	526-534	9
α-helix	540-550	11
β-strand	557-558	2	17
α-helix	560-562	3
α-helix	566-569	4
α-helix	573-575	3
β-strand	576-581	6	17
β-strand	584-589	6	17
α-helix	593-596	4
α-helix	603-609	7
α-helix	615-620	6
α-helix	644-659	16
β-strand	662-669	8	11
α-helix	684-690	7
α-helix	694-700	7
β-strand	707-710	4	18
α-helix	711-718	8
α-helix	719-721	3
α-helix	726-728	3
α-helix	731-742	12
β-strand	749-751	3	18
β-strand	755-758	4	18
α-helix	763-770	8
α-helix	774-790	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-VI	I, J, K, L, M, N	protein	816	Sus scrofa	Q29122 (AlphaFold model)
Actin, alpha skeletal muscle	A, B, C, D, E, F, G, H	protein	373	Oryctolagus cuniculus	P68135 (AlphaFold model)

Sequence of entity 1 (I, J, K, L, M, N), FASTA

>6BNW_1 Unconventional myosin-VI (chains I, J, K, L, M, N)
EDGKPVWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVED
NCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLG
TMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDR
IVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKE
ERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYL
KAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGG
CNLKNKSTQALEYCAELLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARD
ALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQ
QFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGILDILDEENRLPQPSDQ
HFTSAVHQKHKDHFRLSIPRKSKLAIHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDAL
HMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRST
GASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKY
MPDKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELV
KRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRAEAC

Sequence of entity 2 (A, B, C, D, E, F, G, H), FASTA

>6BNW_2 Actin, alpha skeletal muscle (chains A, B, C, D, E, F, G, H)
MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
MSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIT
KQEYDEAGPSIVH

Primary citation

Cryo-EM structures reveal specialization at the myosin VI-actin interface and a mechanism of force sensitivity. Gurel, P.S., Kim, L.Y., Ruijgrok, P.V. et al. Elife (2017) 6. DOI 10.7554/eLife.31125 · PubMed

Other PDB entries of the same protein (UniProt Q29122 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V26 1.75 Å, Myosin VI (MD) pre-powerstroke state (Mg.ADP.VO4)
4DBR 1.95 Å, Myosin VI D179Y (MD) pre-powerstroke state
2X51 2.2 Å, M6 delta Insert1
3L9I 2.2 Å, Myosin VI nucleotide-free (mdinsert2) L310G mutant crystal structure
4DBP 2.2 Å, Myosin VI nucleotide-free (MDINSERT2) D179Y crystal structure
5O2L 2.2 Å, Myosin VI motor domain in the Pre-Transition State
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
2BKH 2.4 Å, Myosin VI nucleotide-free (MDInsert2) crystal structure
2VAS 2.4 Å, Myosin VI (MD-insert2-CaM, Delta-Insert1) Post-rigor state
4ANJ 2.6 Å, MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
4DBQ 2.6 Å, MYOSIN VI D179Y (MD-INSERT2-CAM, DELTA-INSERT1) post-rigor state
3GN4 2.7 Å, Myosin lever arm

Browse structure collections

About this viewer

MolViewer shows 6BNW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.