6BPH: Chromodomain of RBBP1

Crystal structure of the chromodomain of RBBP1. Determined by X-ray diffraction at 1.85 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 1
Atoms: 578
Mol. weight: 8.07 kDa
Released: 20 Dec 2017

Explore 6BPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BPH contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	578-583	6	1
α-helix	586-588	3
β-strand	590-602	13	1
β-strand	605-612	8	1
α-helix	617-619	3
β-strand	621-624	4	1
α-helix	625-627	3
β-strand	628-629	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT-rich interactive domain-containing protein 4A	A	protein	69	Homo sapiens	P29374 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BPH_1 AT-rich interactive domain-containing protein 4A (chains A)
GEDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKAD
RIIWPLDKG

Primary citation

Crystal structure of chromo barrel domain of RBBP1. Lei, M., Feng, Y., Zhou, M. et al. Biochem Biophys Res Commun (2018) 496:1344-1348. DOI 10.1016/j.bbrc.2018.02.016 · PubMed

Other PDB entries of the same protein (UniProt P29374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V8N 2.05 Å, Crystal structure of the PWWP-ARID domain of ARID4A
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
2LCC Solution structure of RBBP1 chromobarrel domain
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1
2YRV Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1
6L87 Solution structure of the tandem PWWP-ARID domains of human RBBP1

Browse structure collections

About this viewer

MolViewer shows 6BPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.