7V8N: PWWP-ARID domain of ARID4A

Crystal structure of the PWWP-ARID domain of ARID4A. Determined by X-ray diffraction at 2.05 Å resolution. Released 31 Aug 2022.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,589
Mol. weight: 58.06 kDa
Released: 31 Aug 2022

Explore 7V8N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V8N contains 29 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	169-173	5
β-strand	178-182	5	1
β-strand	190-196	7	1
α-helix	198-200	3
β-strand	210-215	6	1
β-strand	221-225	5	1
α-helix	226-228	3
β-strand	229-231	3	1
α-helix	239-243	5
α-helix	246-257	12
α-helix	259-261	3
α-helix	262-264	3
α-helix	268-271	4
α-helix	309-326	18
β-strand	335	1	2
β-strand	340	1	2
α-helix	343-352	10
α-helix	356-358	3
α-helix	362-371	10
α-helix	381-392	12
α-helix	394-403	10
β-strand	408	1	3
β-strand	412	1	3

Chain B: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	169-174	6
β-strand	178-182	5	4
α-helix	183	1
β-strand	190-196	7	4
α-helix	198-200	3
β-strand	210-215	6	4
β-strand	221-225	5	4
α-helix	226-228	3
β-strand	229-231	3	4
α-helix	234-236	3
α-helix	248-257	10
α-helix	262-264	3
α-helix	268-270	3
α-helix	309-325	17
α-helix	333-334	2
β-strand	335-336	2	5
β-strand	339-340	2	5
α-helix	343-352	10
α-helix	356-358	3
α-helix	362-371	10
α-helix	381-392	12
α-helix	394-403	10
β-strand	408	1	6
β-strand	412	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT-rich interactive domain-containing protein 4A	A, B	protein	253	Homo sapiens	P29374 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7V8N_1 AT-rich interactive domain-containing protein 4A (chains A, B)
GPGSRLNDELLGKVVSVVSATERTEWYPALVISPSCNDDITVKKDQCLVRSFIDSKFYSI
ARKDIKEVDILNLPESELSTKPGLQKASIFLKTRVVPDNWKMDISEILESSSSDDEDGPA
EENDEEKEKEAKKTEEEVPEEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLF
KLFRLVYHQGGCDNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYCRSAN
IQFRTVHHHEPKV

Primary citation

Crystal structure of the PWWP-ARID of ARID4A. Ren, D., Wei, X., Lin, L. et al. To be published.

Other PDB entries of the same protein (UniProt P29374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BPH 1.85 Å, Crystal structure of the chromodomain of RBBP1
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
2LCC Solution structure of RBBP1 chromobarrel domain
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1
2YRV Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1
6L87 Solution structure of the tandem PWWP-ARID domains of human RBBP1

Browse structure collections

About this viewer

MolViewer shows 7V8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.