6L87: Tandem PWWP-ARID domains of human RBBP1

Solution structure of the tandem PWWP-ARID domains of human RBBP1. Determined by solution NMR. Released 6 Jan 2021.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,874
Mol. weight: 26.6 kDa
Released: 6 Jan 2021

Explore 6L87 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L87 contains 11 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
β-strand	16-25	10	1
β-strand	40-44	5	1
β-strand	52-55	4	1
β-strand	59-61	3	1
α-helix	64-66	3
α-helix	69-74	6
α-helix	76-86	11
α-helix	98-101	4
α-helix	118-131	14
β-strand	142-143	2	2
β-strand	146-147	2	2
α-helix	150-159	10
α-helix	163-165	3
α-helix	169-179	11
α-helix	186-199	14
α-helix	201-209	9
α-helix	216-218	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AT-rich interactive domain-containing protein 4A	A	protein	229	Homo sapiens	P29374 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6L87_1 AT-rich interactive domain-containing protein 4A (chains A)
NDELLGKVVSVVSATERTEWYPALVISPSCNDDITVKKDQCLVRSFIDSKFYSIARKDIK
EVDILNLPESELSTKPGLQKASIFLKTRVVPDNWKMDISEILESSSSKDKEKELDPEERD
NFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYHQGGCDNIDSGAVWKQIYMDLG
IPILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTVHHHELEHHHHHH

Primary citation

Structural insight into chromatin recognition by multiple domains of the tumor suppressor RBBP1. Gong, W., Liang, Q., Tong, Y. et al. J Mol Biol (2021):167224-167224. DOI 10.1016/j.jmb.2021.167224 · PubMed

Other PDB entries of the same protein (UniProt P29374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BPH 1.85 Å, Crystal structure of the chromodomain of RBBP1
7V8N 2.05 Å, Crystal structure of the PWWP-ARID domain of ARID4A
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
2LCC Solution structure of RBBP1 chromobarrel domain
2MAM Solution structure of the interdigitated double Tudor domain of RBBP1
2YRV Solution structure of the RBB1NT domain of human RB(retinoblastoma)-binding protein 1

Browse structure collections

About this viewer

MolViewer shows 6L87 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.