6BXJ: Single-chain beta3 integrin

Structure of a single-chain beta3 integrin. Determined by X-ray diffraction at 2.09 Å resolution. Released 3 Oct 2018.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,441
Mol. weight: 70.45 kDa
Ligands: NAG, MG
Released: 3 Oct 2018

Explore 6BXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BXJ contains 28 α-helices and 49 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	13-19	7
β-strand	23-25	3	1
β-strand	38-40	3	1
α-helix	41-46	6
β-strand	55	1	1
β-strand	60-65	6	2
α-helix	67-70	4
β-strand	83-84	2	3
β-strand	87-92	6	2
β-strand	97-105	9	3
β-strand	112-119	8	4
β-strand	121	1	5
α-helix	126-142	17
β-strand	148-155	8	4
β-strand	159-163	5	4
α-helix	165-171	7
α-helix	174-177	4
β-strand	186	1	5
α-helix	190-200	11
α-helix	204-206	3
β-strand	213-220	8	4
α-helix	231-233	3
β-strand	237-243	7	4
α-helix	245-247	3
α-helix	250-254	5
α-helix	257-259	3
α-helix	261	1
α-helix	264-267	4
β-strand	268-271	4	4
α-helix	274-279	6
α-helix	281-287	7
β-strand	292-293	2	6
β-strand	294-297	4	2
β-strand	303-310	8	3
β-strand	316-318	3	3
β-strand	322-323	2	6
α-helix	326-327	2
β-strand	331-340	10	3
β-strand	349-355	7	2
β-strand	362-368	7	2
α-helix	373-377	5
β-strand	379-380	2	7
β-strand	391-393	3	7
β-strand	396-398	3	7
β-strand	404	1	8
β-strand	410	1	8
α-helix	430	1
α-helix	431-434	4
β-strand	436-439	4	9
β-strand	442-445	4	9
α-helix	446-447	2
β-strand	453-454	2	10
β-strand	460-461	2	10
β-strand	467-468	2	11
β-strand	471-472	2	11
α-helix	473-475	3
β-strand	477-480	4	12
β-strand	483-486	4	12
β-strand	490-491	2	13
β-strand	497-498	2	13
α-helix	502-504	3
β-strand	505	1	14
β-strand	511	1	14
α-helix	512-514	3
β-strand	516-519	4	15
β-strand	522-525	4	15
β-strand	531	1	16
β-strand	537	1	16
α-helix	544-551	8
α-helix	552-556	5
α-helix	561-564	4
α-helix	568-571	4
β-strand	575-579	5	17
β-strand	589-595	7	17
β-strand	601-608	8	17
β-strand	614-619	6	17
β-strand	623	1	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Integrin beta-3 and Integrin alpha-L	A	protein	625	Homo sapiens	P05106 (AlphaFold model), P20701 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BXJ_1 Chimera protein of Integrin beta-3 and Integrin alpha-L (chains A)
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSE
ARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDGNVDLVFLFDG
SMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKH
VKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYI
IGIGKHFQTKESQETLHKFASKPASEFVKILDTFEKLKDLFTELQKKIRSKVELEVRDLP
EELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKD
SLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQ
DECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCS
CGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPT
CPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDC
VVRFQYYEDSSGKSILYVVEEPECP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4
MG	Magnesium ion	Mg	2

Primary citation

Autonomous conformational regulation of beta3integrin and the conformation-dependent property of HPA-1a alloantibodies. Thinn, A.M.M., Wang, Z., Zhou, D. et al. Proc Natl Acad Sci U S A (2018) 115:E9105-E9114. DOI 10.1073/pnas.1806205115 · PubMed

Other PDB entries of the same protein (UniProt P05106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
7UDH 2.0 Å, Integrin alpha IIB beta3 complex with BMS4-3
4HXJ 2.0 Å, Crystal structure of SH3:RGT complex
7UBR 2.05 Å, Integrin alpha IIB beta3 complex with GR144053
1MK7 2.2 Å, Crystal structure of an integrin BETA3-talin chimera
3T3P 2.2 Å, A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly…
7TMZ 2.2 Å, Integrin alpha IIB beta3 complex with BMS compound 4
2Q6W 2.25 Å, The structure of HLA-DRA, DRB3*0101 (DR52a) with bound platelet integrin peptide…
3NIG 2.25 Å, The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific…
7U9V 2.25 Å, Integrin alpha IIB beta3 complex with BMS4-1
3NID 2.3 Å, The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3…
7L8P 2.35 Å, Integrin alphaIIbbeta3 in complex with sibrafiban

Browse structure collections

About this viewer

MolViewer shows 6BXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.