6BYJ: Human 14-3-3 gamma

Structure of human 14-3-3 gamma bound to O-GlcNAc peptide. Determined by X-ray diffraction at 2.9 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Homo sapiens, synthetic construct
Chains: 9
Atoms: 11,720
Mol. weight: 172.76 kDa
Ligands: NAG
Released: 9 May 2018

Explore 6BYJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BYJ contains 76 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-32	13
α-helix	36-37	2
α-helix	39-70	32
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-135	19
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-187	6
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-240	25

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-69	31
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-137	21
α-helix	141-164	24
α-helix	170-186	17
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-236	21

Chain C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	39-69	31
α-helix	70-73	4
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-205	16
α-helix	208-210	3
α-helix	216-236	21

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	39-70	32
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	215-237	23

Chain E: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-73	35
α-helix	76-103	28
α-helix	104-108	5
α-helix	109-111	3
α-helix	117-135	19
α-helix	141-164	24
α-helix	170-185	16
α-helix	190-206	17
α-helix	216-234	19
α-helix	235-237	3

Chain F: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-67	29
α-helix	69-73	5
α-helix	77-103	27
α-helix	104-108	5
α-helix	117-134	18
α-helix	140-158	19
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-230	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein gamma	A, B, C, D, E, F	protein	240	Homo sapiens	P61981 (AlphaFold model)
TSTTATPPVSQASSTTTSTW O-GlcNac peptide	G, P, T	protein	20	synthetic construct

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6BYJ_1 14-3-3 protein gamma (chains A, B, C, D, E, F)
VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR
VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV
FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV
FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD

Sequence of entity 2 (G, P, T), FASTA

>6BYJ_2 TSTTATPPVSQASSTTTSTW O-GlcNac peptide (chains G, P, T)
TSTTATPPVSQASSTTTSTW

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Structural basis of O-GlcNAc recognition by mammalian 14-3-3 proteins. Toleman, C.A., Schumacher, M.A., Yu, S.H. et al. Proc Natl Acad Sci U S A (2018) 115:5956-5961. DOI 10.1073/pnas.1722437115 · PubMed

Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
2B05 2.55 Å, Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
6GKF 2.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139
6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
7A6R 2.7 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding…
5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795

Browse structure collections

About this viewer

MolViewer shows 6BYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.