6BZW: AP33 GL Heavy Chain

Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the GL precursor of the broadly neutralizing antibody AP33. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Jun 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Mus musculus, Hepatitis C virus
Chains: 12
Atoms: 14,240
Mol. weight: 197.57 kDa
Released: 20 Jun 2018

Explore 6BZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BZW contains 61 α-helices and 195 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	11-12	2	14
β-strand	18-25	8	13
β-strand	33-39	7	15
β-strand	45-52	8	15
β-strand	57-59	3	15
β-strand	67-72	6	13
β-strand	77-82	6	13
α-helix	84-86	3
β-strand	88-95	8	15
β-strand	100B-103	4	15
α-helix	104-106	3
β-strand	107-109	3	15
β-strand	110-111	2	14
α-helix	115-116	2
β-strand	117	1	16
α-helix	118-119	2
β-strand	120-124	5	17
β-strand	131-132	2	17
β-strand	135-145	11	17
β-strand	146	1	16
β-strand	151-154	4	18
α-helix	155-157	3
β-strand	159	1	18
β-strand	164-165	2	17
α-helix	166-168	3
β-strand	169-170	2	17
β-strand	176-185	10	17
α-helix	186-188	3
β-strand	194-200	7	18
α-helix	201-203	3
β-strand	205-211	7	18

Chains B and F: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-14	5	20
β-strand	19-25	7	19
β-strand	27C-27D	2	21
β-strand	30-31	2	21
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-67	6	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	84-90	7	20
α-helix	96	1
β-strand	97-98	2	20
β-strand	102-107	6	20
β-strand	111	1	22
α-helix	112-113	2
β-strand	114-118	5	23
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	23
β-strand	140	1	22
β-strand	144-150	7	24
β-strand	153-154	2	24
β-strand	159-163	5	23
β-strand	173-182	10	23
α-helix	183-187	5
β-strand	191-198	8	24
β-strand	205-210	6	24

Chain C: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
β-strand	33-39	7	3
β-strand	45-52	8	3
β-strand	57-59	3	3
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	3
β-strand	100B-103	4	3
α-helix	104-106	3
β-strand	107-109	3	3
β-strand	110-111	2	2
α-helix	115-116	2
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
β-strand	131-132	2	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	159	1	6
β-strand	164-165	2	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-185	10	5
α-helix	186-188	3
β-strand	194-200	7	6
α-helix	201-203	3
β-strand	205-211	7	6

Chain D: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	27C-27D	2	9
β-strand	30-31	2	9
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
α-helix	96	1
β-strand	97-98	2	8
β-strand	102-107	6	8
β-strand	111	1	10
α-helix	112-113	2
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	11
β-strand	140	1	10
β-strand	144-150	7	12
β-strand	153-154	2	12
β-strand	159-163	5	11
β-strand	173-182	10	11
α-helix	183-187	5
β-strand	191-198	8	12
β-strand	205-210	6	12

Chain E: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	25
β-strand	11-12	2	26
β-strand	18-25	8	25
β-strand	33-39	7	27
β-strand	45-52	8	27
β-strand	57-59	3	27
β-strand	67-72	6	25
β-strand	77-82	6	25
α-helix	84-86	3
β-strand	88-95	8	27
β-strand	100B-103	4	27
β-strand	107-109	3	27
β-strand	110-111	2	26
α-helix	115-116	2
β-strand	117	1	28
α-helix	118-119	2
β-strand	120-124	5	29
β-strand	131-132	2	29
β-strand	135-145	11	29
β-strand	146	1	28
β-strand	151-154	4	30
α-helix	155-157	3
β-strand	164-165	2	29
α-helix	166-168	3
β-strand	169-170	2	29
β-strand	176-185	10	29
α-helix	186-188	3
β-strand	194-200	7	30
α-helix	201-203	3
β-strand	205-211	7	30

Chain G: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	37
β-strand	11-12	2	38
β-strand	18-25	8	37
β-strand	33-40	8	39
β-strand	44-52	9	39
β-strand	57-59	3	39
α-helix	64-66	3
β-strand	67-72	6	37
β-strand	77-82	6	37
α-helix	84-86	3
β-strand	88-95	8	39
β-strand	100B-103	4	39
β-strand	107-109	3	39
β-strand	110-111	2	38
α-helix	115-116	2
β-strand	117	1	40
α-helix	118-119	2
β-strand	120-124	5	41
β-strand	131-132	2	41
β-strand	135-145	11	41
β-strand	146	1	40
β-strand	151-154	4	42
α-helix	155-157	3
β-strand	159	1	42
β-strand	164-165	2	41
α-helix	166-168	3
β-strand	169-170	2	41
β-strand	176-185	10	41
α-helix	186-188	3
β-strand	195-200	6	42
α-helix	201-203	3
β-strand	205-210	6	42

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	43
β-strand	10-14	5	44
β-strand	19-25	7	43
β-strand	27C-27D	2	45
β-strand	30-31	2	45
β-strand	33-38	6	44
β-strand	45-49	5	44
β-strand	53-54	2	44
α-helix	55	1
β-strand	62-67	6	43
β-strand	70-75	6	43
α-helix	80-82	3
β-strand	84-90	7	44
α-helix	96	1
β-strand	97-98	2	44
β-strand	102-107	6	44
β-strand	111	1	46
α-helix	112-113	2
β-strand	114-118	5	47
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	47
β-strand	140	1	46
β-strand	145-150	6	48
β-strand	153-154	2	48
β-strand	159-163	5	47
α-helix	164-167	4
β-strand	173-182	10	47
α-helix	183-187	5
β-strand	191-197	7	48
β-strand	205-210	6	48

Chains I, K and L: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	415-416	2	49
β-strand	419-420	2	49

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP33 GL Heavy Chain	A, C, E, G	protein	223	Mus musculus
AP33 GL Light Chain	B, D, F, H	protein	219	Mus musculus
E2 AS412 peptide	I, J, K, L	protein	13	Hepatitis C virus	P27958 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>6BZW_1 AP33 GL Heavy Chain (chains A, C, E, G)
EVQLLESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYN
PSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCARITTAYYAMDYWGQGTSVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGS

Sequence of entity 2 (B, D, F, H), FASTA

>6BZW_2 AP33 GL Light Chain (chains B, D, F, H)
IELVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLLIYLASNLE
SGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPWTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (I, J, K, L), FASTA

>6BZW_3 E2 AS412 peptide (chains I, J, K, L)
RQLINTNGSWHIN

Primary citation

Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors. Aleman, F., Tzarum, N., Kong, L. et al. Proc Natl Acad Sci U S A (2018) 115:7569-7574. DOI 10.1073/pnas.1802378115 · PubMed

Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZY 1.6 Å, Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423…
5FGB 1.65 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQJ 1.69 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
2XI3 1.7 Å, HCV-H77 NS5B Polymerase Complexed With GTP
4N0Y 1.75 Å, Structure of the Hepatitis C Envelope Glycoprotein E1 antigenic region 314-324 bound to…
2XI2 1.8 Å, HCV-H77 NS5B Apo Polymerase
6UYD 1.9 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
5FGC 1.9 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQK 1.97 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
5EOC 1.98 Å, Crystal structure of Fab C2 in complex with a Cyclic variant of Hepatitis C Virus E2…
2O8M 2.0 Å, Crystal structure of the S139A mutant of Hepatitis C Virus NS3/4A protease
4XVJ 2.0 Å, Structure of the hepatitis C virus envelope glycoprotein E2 antigenic 2 region 412-423…

Browse structure collections

About this viewer

MolViewer shows 6BZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.