6C5X: SOCS1

Crystal Structure of SOCS1 in complex with ElonginB and ElonginC. Determined by X-ray diffraction at 3.1 Å resolution. Released 2 May 2018.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 7
Atoms: 5,069
Mol. weight: 87.13 kDa
Released: 2 May 2018

Explore 6C5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6C5X contains 36 α-helices and 45 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	63-76	14
β-strand	80-83	4	11
α-helix	86-94	9
α-helix	97	1
β-strand	100-105	6	11
β-strand	113-118	6	11
β-strand	123-131	9	11
β-strand	134-137	4	11
β-strand	144	1	11
α-helix	147-156	10
β-strand	164-165	2	11
α-helix	174-185	12
α-helix	190-192	3
α-helix	198-206	9

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	10	1	2
β-strand	12-19	8	1
β-strand	23	1	3
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	1
β-strand	49-50	2	1
α-helix	51-52	2
β-strand	56	1	3
β-strand	68	1	4
β-strand	71	1	4
α-helix	72	1
β-strand	73-79	7	1
β-strand	80-81	2	5
β-strand	84-85	2	5
α-helix	86-88	3
β-strand	90	1	2
α-helix	91-94	4

Chains C and F: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	1
β-strand	28-32	5	1
α-helix	33-36	4
α-helix	40-44	5
β-strand	59-61	3	1
α-helix	67-83	17
α-helix	90-92	3
α-helix	97-110	14

Chain D: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	71-76	6
β-strand	80	1	10
α-helix	86-93	8
α-helix	97	1
β-strand	100-105	6	10
β-strand	111-118	8	10
β-strand	123-131	9	10
β-strand	134-137	4	10
β-strand	143-144	2	10
α-helix	147-156	10
β-strand	164-165	2	10
α-helix	174-185	12
α-helix	198-206	9

Chain E: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	6
β-strand	10	1	7
β-strand	12-19	8	6
β-strand	23	1	8
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	6
β-strand	49-50	2	6
α-helix	51-52	2
β-strand	56	1	8
α-helix	72	1
β-strand	73-79	7	6
β-strand	80-81	2	9
β-strand	84-85	2	9
α-helix	86-88	3
β-strand	90	1	7
α-helix	91-94	4
α-helix	98-100	3

Chain G: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	758	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongin-B	B, E	protein	118	Homo sapiens	Q15370 (AlphaFold model)
Elongin-C	C, F	protein	96	Homo sapiens	Q15369 (AlphaFold model)
Suppressor of Cytokine Signalling 1	A, D	protein	164	Xenopus laevis	C0LEJ4 (AlphaFold model)
GP130 peptide fragment	G	protein	10	Homo sapiens	Q00560 (AlphaFold model)

Sequence of entity 1 (B, E), FASTA

>6C5X_1 Elongin-B (chains B, E)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence of entity 2 (C, F), FASTA

>6C5X_2 Elongin-C (chains C, F)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 3 (A, D), FASTA

>6C5X_3 Suppressor of Cytokine Signalling 1 (chains A, D)
LLLSDTHFRTFRSHSDFTVITKTSSMLDTCGFYWGPMDVNVAHDKLKSEPIGTFLIRDSK
QKNCFFAISVKTARETVSIRIKFHAGKFSLDGSKELFSCLFQLVEHYMTSPKKMLVSPLR
KVRLRPLQELCRKSILATFGRQNLDSIPLNRVLKDYLKSFPFQI

Sequence of entity 4 (G), FASTA

>6C5X_4 GP130 peptide fragment (chains G)
TVEYSTVVHS

Primary citation

The molecular basis of JAK/STAT inhibition by SOCS1. Liau, N.P.D., Laktyushin, A., Lucet, I.S. et al. Nat Commun (2018) 9:1558-1558. DOI 10.1038/s41467-018-04013-1 · PubMed

Other PDB entries of the same protein (UniProt Q15370 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z76 1.32 Å, Crystal structure of compound 10 in complex with the bromodomain of human SMARCA2 and…
9GIO 1.49 Å, Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of…
7JTO 1.7 Å, Crystal structure of Protac MS33 in complex with the WD repeat-containing protein 5 and…
8BDS 1.72 Å, Ternary complex between VCB, BRD4-BD1 and PROTAC 48
4AJY 1.73 Å, von Hippel-Lindau protein-ElonginB-ElonginC complex, bound to Hif1- alpha peptide
6GMR 1.75 Å, pVHL:EloB:EloC in complex with (4-(1H-pyrrol-1-yl)phenyl)methanol
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
7ZLM 1.79 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound MN551
6I7Q 1.8 Å, Structure of pVHL-elongin B-elongin C (VCB) in complex with hydroxylated-HIF-2alpha…
8BB3 1.8 Å, Structure of human WDR5 and pVHL:ElonginC:ElonginB bound to PROTAC with PEG linker…
6GFX 1.83 Å, pVHL:EloB:EloC in complex with modified HIF-1a CODD peptide containing…
1LM8 1.85 Å, Structure of a HIF-1a-pVHL-ElonginB-ElonginC Complex

Browse structure collections

About this viewer

MolViewer shows 6C5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.