6CMC: Acid-sensing ion channel 1

Barium sites in the structure of a desensitized acid sensing ion channel. Determined by X-ray diffraction at 3.67 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 3.67 Å
Organism: Gallus gallus
Chains: 1
Atoms: 3,226
Mol. weight: 51.36 kDa
Released: 8 Aug 2018

Explore 6CMC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CMC contains 27 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	43-46	4
α-helix	49-69	21
β-strand	74-81	8	1
β-strand	86-87	2	2
α-helix	88-89	2
β-strand	90-95	6	3
β-strand	100	1	4
α-helix	106-112	7
α-helix	135-142	8
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	1
β-strand	178-179	2	1
α-helix	180	1
α-helix	182-184	3
β-strand	185-190	6	3
β-strand	193-198	6	3
α-helix	205-208	4
β-strand	209-210	2	2
α-helix	215-217	3
β-strand	219-224	6	1
α-helix	227-229	3
β-strand	230	1	4
α-helix	231-232	2
β-strand	246-251	6	3
α-helix	259-262	4
β-strand	264-266	3	3
β-strand	270-282	13	1
α-helix	284-285	2
β-strand	292	1	5
α-helix	306-322	17
β-strand	325	1	6
α-helix	334	1
β-strand	335	1	6
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-350	5
α-helix	351-355	5
α-helix	363-364	2
β-strand	365	1	5
β-strand	367-379	13	1
α-helix	383-392	10
α-helix	397-403	7
β-strand	404-423	20	1
α-helix	427-441	15
α-helix	446-452	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A	protein	450	Gallus gallus	Q1XA76 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CMC_1 Acid-sensing ion channel 1 (chains A)
GQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYP
HVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADE
KQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYG
KCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQ
DEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDC
ETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGK
ELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGD
IGGQMGLFIGASILTVLELFDYAYEVIKHR

Primary citation

Divalent cation and chloride ion sites of chicken acid sensing ion channel 1a elucidated by x-ray crystallography. Yoder, N., Gouaux, E. PLoS One (2018) 13:e0202134-e0202134. DOI 10.1371/journal.pone.0202134 · PubMed

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…

Browse structure collections

About this viewer

MolViewer shows 6CMC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.