Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent Cross-Reactive Neutralizing Human Monoclonal Antibody m102.3. Determined by X-ray diffraction at 2.7 Å resolution. Released 18 Apr 2018.
Explore 6CMG in 3D Show helices and sheets RCSB PDB PDBe
6CMG contains 14 α-helices and 79 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 178-179 | 2 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 201-202 | 2 | 1 |
| β-strand | 215-225 | 11 | 2 |
| β-strand | 228-237 | 10 | 2 |
| β-strand | 244-257 | 14 | 2 |
| β-strand | 263-271 | 9 | 2 |
| β-strand | 279-287 | 9 | 3 |
| β-strand | 290-297 | 8 | 3 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-320 | 7 | 3 |
| β-strand | 332-337 | 6 | 3 |
| β-strand | 339-341 | 3 | 4 |
| β-strand | 347-350 | 4 | 4 |
| β-strand | 354 | 1 | 3 |
| β-strand | 356-358 | 3 | 4 |
| β-strand | 361-371 | 11 | 4 |
| α-helix | 372-374 | 3 | |
| α-helix | 379-381 | 3 | |
| α-helix | 394-397 | 4 | |
| β-strand | 407-417 | 11 | 4 |
| β-strand | 425-430 | 6 | 4 |
| β-strand | 431 | 1 | 5 |
| α-helix | 432 | 1 | |
| β-strand | 442-447 | 6 | 6 |
| β-strand | 450-455 | 6 | 6 |
| β-strand | 465-471 | 7 | 6 |
| β-strand | 475 | 1 | 5 |
| β-strand | 476-479 | 4 | 6 |
| β-strand | 509 | 1 | 1 |
| β-strand | 511-515 | 5 | 7 |
| β-strand | 520-526 | 7 | 7 |
| β-strand | 533 | 1 | 8 |
| β-strand | 535-540 | 6 | 7 |
| β-strand | 545-550 | 6 | 7 |
| β-strand | 557 | 1 | 8 |
| β-strand | 558-568 | 11 | 1 |
| β-strand | 571-582 | 12 | 1 |
| β-strand | 587-596 | 10 | 1 |
| α-helix | 597-598 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 9 |
| β-strand | 12-13 | 2 | 10 |
| β-strand | 19-25 | 7 | 9 |
| α-helix | 31-33 | 3 | |
| β-strand | 34-39 | 6 | 11 |
| β-strand | 45-49 | 5 | 11 |
| β-strand | 55 | 1 | 11 |
| β-strand | 63-68 | 6 | 9 |
| β-strand | 71-76 | 6 | 9 |
| α-helix | 81-83 | 3 | |
| β-strand | 86-91 | 6 | 11 |
| β-strand | 93 | 1 | 12 |
| β-strand | 97-98 | 2 | 11 |
| β-strand | 102-103 | 2 | 11 |
| β-strand | 105-106 | 2 | 10 |
| β-strand | 111 | 1 | 13 |
| β-strand | 114-118 | 5 | 14 |
| β-strand | 129-139 | 11 | 14 |
| β-strand | 140 | 1 | 13 |
| β-strand | 145-150 | 6 | 15 |
| β-strand | 154 | 1 | 15 |
| β-strand | 159-163 | 5 | 14 |
| β-strand | 173-182 | 10 | 14 |
| β-strand | 191-197 | 7 | 15 |
| β-strand | 205-210 | 6 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 16 |
| β-strand | 10-12 | 3 | 12 |
| β-strand | 18-24 | 7 | 16 |
| β-strand | 33-39 | 7 | 12 |
| β-strand | 45-52 | 8 | 12 |
| β-strand | 57-60 | 4 | 12 |
| α-helix | 62-64 | 3 | |
| β-strand | 65 | 1 | 16 |
| β-strand | 68-73 | 6 | 16 |
| β-strand | 78-83 | 6 | 16 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-105 | 14 | 12 |
| β-strand | 112-122 | 11 | 12 |
| β-strand | 126-130 | 5 | 12 |
| α-helix | 137-138 | 2 | |
| β-strand | 139-143 | 5 | 17 |
| β-strand | 154-164 | 11 | 17 |
| β-strand | 170-173 | 4 | 18 |
| β-strand | 178 | 1 | 18 |
| β-strand | 182-184 | 3 | 17 |
| α-helix | 185-187 | 3 | |
| β-strand | 188-189 | 2 | 17 |
| β-strand | 195-204 | 10 | 17 |
| α-helix | 205-207 | 3 | |
| β-strand | 214-218 | 5 | 18 |
| β-strand | 219 | 1 | 19 |
| β-strand | 224 | 1 | 19 |
| β-strand | 227-229 | 3 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycoprotein G | A | protein | 428 | Hendra virus | O89343 (AlphaFold model) |
| m102.3 light chain | B | protein | 214 | Homo sapiens | |
| IgG Heavy chain | C | protein | 235 | Homo sapiens |
>6CMG_1 Glycoprotein G (chains A) QGVSDLVGLPNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLE KIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLC AVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSG IKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLK YNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPL RVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENP VFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAV KIPAQCSE
>6CMG_2 m102.3 light chain (chains B) EIVMTQSPGTPSLSPGERATLSCRASQSIRSTYLAWYQQKPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGRSPSFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKLYACEVTHQGLSSPVTKSFNRGEC
>6CMG_3 IgG Heavy chain (chains C) EVQLVQSGAEVKKRGSSVKVSCKSSGGTFSNYAINWVRQAPGQGLEWMGGIIPILGIANY AQKFQGRVTITTDESTSTAYMELSSLRSEDTAVYYCARGWGREQLAPHPSQYYYYYYGMD VWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Crystal structure of the Hendra virus attachment G glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody. Xu, K., Rockx, B., Xie, Y. et al. PLoS Pathog (2013) 9:e1003684. DOI 10.1371/journal.ppat.1003684 · PubMed
Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.