6DCN: Bcl-xL complex with Beclin 1 BH3 domain T108pThr

Bcl-xL complex with Beclin 1 BH3 domain T108pThr. Determined by X-ray diffraction at 2.44 Å resolution. Released 23 May 2018.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,664
Mol. weight: 41.26 kDa
Released: 23 May 2018

Explore 6DCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DCN contains 18 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-19	15
α-helix	26-104	23
α-helix	119-131	13
α-helix	137-156	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	179-183	5
α-helix	187-195	9

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	0-19	20
α-helix	26-104	23
α-helix	116-131	16
α-helix	137-156	20
α-helix	162-173	12
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-195	9

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	108-125	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BCL-xl protein	A, B	protein	156	Homo sapiens	Q07817 (AlphaFold model)
Beclin-1	C, D	protein	26	Homo sapiens	Q14457 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6DCN_1 BCL-xl protein (chains A, B)
PLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQL
HITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMAT
YLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQE

Sequence of entity 2 (C, D), FASTA

>6DCN_2 Beclin-1 (chains C, D)
DGGTMENLSRRLKVTGDLFDIMSGQT

Primary citation

Structural insights into BCL2 pro-survival protein interactions with the key autophagy regulator BECN1 following phosphorylation by STK4/MST1. Lee, E.F., Smith, N.A., Soares da Costa, T.P. et al. Autophagy (2019) 15:785-795. DOI 10.1080/15548627.2018.1564557 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 6DCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.