6DCW: Human anti-tau antibody CBTAU-27.1 Fab

Crystal structure of human anti-tau antibody CBTAU-27.1 Fab in complex with a human tau peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,903
Mol. weight: 51.49 kDa
Released: 6 Jun 2018

Explore 6DCW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DCW contains 20 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	32-39	8	8
α-helix	40	1
β-strand	45-52	8	8
β-strand	56-59	4	8
β-strand	64	1	7
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	100E-103	4	8
β-strand	107-111	5	8
α-helix	115-116	2
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
α-helix	128-130	3
β-strand	133-134	2	10
β-strand	137-147	11	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-178	2	10
β-strand	185-194	10	10
α-helix	195-197	3
β-strand	207-212	6	11
α-helix	213-215	3
β-strand	217-222	6	11

Chain L: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C-27D	2	3
β-strand	30-31	2	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	97	1
β-strand	98	1	2
α-helix	99	1
β-strand	102-107	6	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	144-150	7	6
β-strand	153-154	2	6
α-helix	155	1
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-186	4
β-strand	191-198	8	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Light chain of CBTAU27.1 Fab	L	protein	220	Homo sapiens	P01834 (AlphaFold model)
Heavy chain of CBTAU27.1 Fab	H	protein	231	Homo sapiens	P01857 (AlphaFold model)
tau peptide	T	protein	20	Homo sapiens	A0A2K5IAM2 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>6DCW_1 Light chain of CBTAU27.1 Fab (chains L)
DIQLTQSPDSLAVSLGERATINCKSSQSVFSRDNNKNYLAWYQHKSGQPPKLLFFWASSR
ESGVSDRFSGSGSGTDFTLTIDNLQAEDVALYYCQHYFNTPHNFGQGTKLEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>6DCW_2 Heavy chain of CBTAU27.1 Fab (chains H)
QVQLVESGPEMRKPGESLKISCKTSGYIFSDYWTAWVRQLPGKGLQWMGIIYSGDSDTRY
HPSVQGHVTMSTDSSLTTAYLQWSSLKASDTGIYYCARLDARVDAGWQLDSWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCHHHHHH

Sequence of entity 3 (T), FASTA

>6DCW_3 tau peptide (chains T)
HVPGGGSVQIVYKPVDLSKV

Primary citation

A common antigenic motif recognized by naturally occurring human VH5-51/VL4-1 anti-tau antibodies with distinct functionalities. Apetri, A., Crespo, R., Juraszek, J. et al. Acta Neuropathol Commun (2018) 6:43-43. DOI 10.1186/s40478-018-0543-z · PubMed

Other PDB entries of the same protein (UniProt P01834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EWI 1.6 Å, Crystal Structure of the Human Fab VRC38.01, an HIV-1 V1V2-Directed Neutralizing…
1NGZ 1.6 Å, Chimeric Germline Fab 7g12-apo
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
4XMP 1.78 Å, Crystal structure of broadly and potently neutralizing antibody VRC08 in complex with…
1N0X 1.8 Å, Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a…
3VH8 1.8 Å, KIR3DL1 in complex with HLA-B*5701
3X12 1.8 Å, Crystal structure of HLA-B*57:01.I80N
6B9Z 1.82 Å, Trastuzumab Fab v3
2VXQ 1.9 Å, Crystal structure of the major grass pollen allergen Phl p 2 in complex with its…
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
6DCV 1.9 Å, Crystal structure of human anti-tau antibody CBTAU-27.1

Browse structure collections

About this viewer

MolViewer shows 6DCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.