Structural Determinants of Activation and Biased Agonism at the 5-HT2B Receptor. Determined by X-ray diffraction at 2.92 Å resolution. Released 29 Aug 2018.
Explore 6DRY in 3D Show helices and sheets RCSB PDB PDBe
6DRY contains 21 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 54-60 | 7 | |
| α-helix | 61-65 | 5 | |
| α-helix | 66-81 | 16 | |
| α-helix | 83-85 | 3 | |
| α-helix | 88-102 | 15 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-116 | 9 | |
| α-helix | 127-158 | 32 | |
| α-helix | 169-187 | 19 | |
| α-helix | 189-193 | 5 | |
| α-helix | 211-222 | 12 | |
| α-helix | 223-227 | 5 | |
| α-helix | 228-1018 | 39 | |
| α-helix | 1023-1041 | 19 | |
| α-helix | 1064-1081 | 18 | |
| α-helix | 1084-1097 | 14 | |
| α-helix | 1098-1102 | 5 | |
| α-helix | 1103-349 | 41 | |
| α-helix | 355-374 | 20 | |
| α-helix | 376-381 | 6 | |
| α-helix | 385-395 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 5HT2B receptor, BRIL chimera | A | protein | 411 | Homo sapiens, Escherichia coli | P0ABE7 (AlphaFold model), P41595 (AlphaFold model) |
>6DRY_1 5HT2B receptor, BRIL chimera (chains A) TESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMS LAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIWHLCAISVDRYI AIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFG DFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAADLEDNWETLNDNLKVIEKADNAAQVK DALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA QAAAEQLKTTRNAYIQKYLVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSC NQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKS
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 2 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 1 |
| OLA | Oleic acid | C18 H34 O2 | 1 |
| CLR | Cholesterol | C27 H46 O | 1 |
| H8D | (8beta)-N-[(2S)-1-hydroxybutan-2-yl]-6-methyl-9,10-didehydroergoline-8-carboxam… | C20 H25 N3 O2 | 1 |
Water and common crystallization additives (PEG) are not listed.
Structural determinants of 5-HT2Breceptor activation and biased agonism. McCorvy, J.D., Wacker, D., Wang, S. et al. Nat Struct Mol Biol (2018) 25:787-796. DOI 10.1038/s41594-018-0116-7 · PubMed
Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6DRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.