6DS6: P300 ZZ domain

Crystal structure of p300 ZZ domain in complex with histone H3 peptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 29 Aug 2018.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 525
Mol. weight: 7.01 kDa
Ligands: ZN
Released: 29 Aug 2018

Explore 6DS6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DS6 contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	20-21	2	1
β-strand	24-27	4	2
β-strand	34-35	2	2
α-helix	37-40	4
β-strand	49-52	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein	A	protein	57	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6DS6_1 Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein (chains A)
ARTKQTQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (CL) are not listed.

Primary citation

The ZZ domain of p300 mediates specificity of the adjacent HAT domain for histone H3. Zhang, Y., Xue, Y., Shi, J. et al. Nat Struct Mol Biol (2018) 25:841-849. DOI 10.1038/s41594-018-0114-9 · PubMed

Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BT3 1.05 Å, Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
3T92 1.5 Å, Crystal structure of the Taz2:C/EBPepsilon-TAD chimera protein
5LPM 1.5 Å, Crystal structure of the bromodomain of human Ep300 bound to the inhibitor XDM3d
5NU5 1.6 Å, Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
3BIY 1.7 Å, Crystal structure of p300 histone acetyltransferase domain in complex with a bisubstrate…
6PGU 1.72 Å, Crystal structure of the p300 acetyltransferase domain with allosteric inhibitor CPI-076…
6V8K 1.84 Å, Crystal structure of the p300 acetyltransferase domain with peptide-competitive…
4PZS 1.94 Å, Crystal structure of p300 histone acetyltransferase domain in complex with…
5KJ2 1.95 Å, The novel p300/CBP inhibitor A-485 uncovers a unique mechanism of action to target AR in…
7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7UGI 2.0 Å, Bromodomain of EP300 liganded with BMS-536924
7VHZ 2.0 Å, Crystal structure of EP300 HAT domain in complex with compound 7

Browse structure collections

About this viewer

MolViewer shows 6DS6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.