6E8R: SNX32 PX domain

Structure of the SNX32 PX domain in complex with Chlamydial protein IncE in space group I121. Determined by X-ray diffraction at 2.27 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 2.27 Å
Organisms: Homo sapiens, Chlamydia trachomatis
Chains: 4
Atoms: 2,848
Mol. weight: 39.88 kDa
Released: 26 Sept 2018

Explore 6E8R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6E8R contains 17 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	26-35	10	1
β-strand	40-48	9	1
β-strand	57-63	7	1
α-helix	64-76	13
α-helix	78-80	3
α-helix	84-92	9
α-helix	95-106	12
α-helix	113-147	35
α-helix	151-153	3
α-helix	155-162	8

Chain B: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	26-36	11	2
β-strand	40-48	9	2
β-strand	57-63	7	2
α-helix	64-76	13
α-helix	78-80	3
α-helix	84-92	9
α-helix	95-106	12
α-helix	113-147	35
α-helix	151-153	3
α-helix	155-162	8

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	114-117	4	1
α-helix	118-120	3
α-helix	124-125	2
β-strand	126-129	4	1

Chain D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	113-117	5	2
α-helix	123-125	3
β-strand	126-129	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-32	A, B	protein	150	Homo sapiens	Q86XE0 (AlphaFold model)
IncE	C, D	protein	25	Chlamydia trachomatis	B7SCI5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6E8R_1 Sorting nexin-32 (chains A, B)
SVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVE
NEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVA
MHEVFLQRLAAHPTLRRDHNFFVFLEYGQD

Sequence of entity 2 (C, D), FASTA

>6E8R_2 IncE (chains C, D)
PANGPAVQFFKGKNGSADQVILVTQ

Primary citation

Crystal structure of the SNX32 PX domain in complex with the Chlamydia trachomatis inclusion protein IncE. Paul, B., Collins, B. To be published.

Browse structure collections

About this viewer

MolViewer shows 6E8R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.