6EI6: PDB entry 6EI6

CC2D1B coordinates ESRCT-III activity during the mitotic reformation of the nuclear envelope. Determined by X-ray diffraction at 2.46 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 2.46 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 4,169
Mol. weight: 63.26 kDa
Released: 10 Oct 2018

Explore 6EI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EI6 contains 15 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	580-608	29
α-helix	612-637	26
α-helix	641-644	4
β-strand	645-648	4	1
α-helix	654-656	3
β-strand	665-674	10	2
β-strand	686-691	6	2
β-strand	701-703	3	2
β-strand	707	1	2
β-strand	717-722	6	2
α-helix	728-736	9
β-strand	738-745	8	2
β-strand	754-762	9	2
α-helix	764-767	4
β-strand	771-779	9	2
β-strand	784-795	12	2
α-helix	801-809	9
β-strand	811-814	4	1

Chain B: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	580-608	29
α-helix	612-637	26
α-helix	642-644	3
β-strand	645-648	4	3
α-helix	654-656	3
β-strand	665-674	10	4
β-strand	686-693	8	4
β-strand	699-703	5	4
β-strand	707	1	4
β-strand	717-722	6	4
α-helix	728-736	9
β-strand	738-745	8	4
α-helix	746-747	2
β-strand	754-762	9	4
α-helix	764-767	4
β-strand	771-779	9	4
β-strand	784-795	12	4
α-helix	801-809	9
β-strand	811-814	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coiled-coil and C2 domain-containing protein 1-like	A, B	protein	270	Drosophila melanogaster	Q9VKJ9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6EI6_1 Coiled-coil and C2 domain-containing protein 1-like (chains A, B)
GAMLSTLPVPPSQRDNLEASFAIVSAEECDPTDDICEIGVRMEEQLAKQLMMCKNTRDHH
KAMGDVAGMNRFENLALTVQKDLDLVRYSKRKNEPLPKFHYEKRSFNIVHCNTDLTDSEL
EIVVVRGISYNVANPKDVDTYVRVEFPLLNDESFKTKTNVIRDTSSPDYDERFKVDIQRT
NRQFQRIFKRHGVKFEIYSRGGFLRSDTLIGTVNVKLQPLETKCEIHDTYDLMDGRKQVG
GKLEVKIRVRNPILTKQMEHITEKWLVLDA

Primary citation

CC2D1B Coordinates ESCRT-III Activity during the Mitotic Reformation of the Nuclear Envelope. Ventimiglia, L.N., Cuesta-Geijo, M.A., Martinelli, N. et al. Dev Cell (2018) 47:547-563.e6. DOI 10.1016/j.devcel.2018.11.012 · PubMed

Other PDB entries of the same protein (UniProt Q9VKJ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VNY 1.1 Å, Crystal structure of DM14-3 domain of Lgd
5VO5 2.0 Å, Crystal structure of Lgd-Shrub complex, single chain fusion
7ZSS 2.63 Å, cryo-EM structure of D614 spike in complex with de novo designed binder
7ZRV 2.8 Å, cryo-EM structure of omicron spike in complex with de novo designed binder, full map
7ZSD 3.29 Å, cryo-EM structure of omicron spike in complex with de novo designed binder, local

Browse structure collections

About this viewer

MolViewer shows 6EI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.