6EN7: Ribosome assembly factor Nsa1

Crystal structure of the ribosome assembly factor Nsa1. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Dec 2017.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 3,185
Mol. weight: 51.98 kDa
Released: 27 Dec 2017

Explore 6EN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EN7 contains 9 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	12-17	6	1
β-strand	22-23	2	2
β-strand	30	1	2
β-strand	34-38	5	1
α-helix	43-45	3
β-strand	47-54	8	3
β-strand	57-62	6	3
β-strand	66-76	11	3
β-strand	104-114	11	3
β-strand	140-145	6	4
β-strand	154-159	6	4
β-strand	163-169	7	4
β-strand	175-182	8	4
α-helix	184	1
α-helix	186	1
β-strand	189-192	4	5
β-strand	204-209	6	5
β-strand	212-219	8	5
β-strand	226-231	6	5
α-helix	234-237	4
α-helix	243-245	3
β-strand	248-254	7	6
α-helix	255-257	3
β-strand	269-274	6	6
β-strand	278-283	6	6
β-strand	292-295	4	6
α-helix	298-300	3
β-strand	303-308	6	7
β-strand	317	1	8
β-strand	323	1	8
α-helix	328-330	3
β-strand	332-337	6	7
β-strand	342-346	5	7
β-strand	351-354	4	7
β-strand	366-370	5	2
β-strand	374-378	5	2
β-strand	383-388	6	2
β-strand	394-399	6	2
β-strand	404-411	8	1
α-helix	413-415	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome biogenesis protein NSA1	A	protein	463	Saccharomyces cerevisiae	P53136 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EN7_1 Ribosome biogenesis protein NSA1 (chains A)
MRLLVSCVDSGSIKEVLCNIGTDTSVQSALQPFHVAPHLAEGLKAYVDRMWVISEDEAIL
ARNSGVVELVKISKHLKENEALQVDPKGESKNEKSLSDDLPKFDISEFEITSSVSDLFDD
AKLESLSSKSVKRTKLVDGFVTLCPIKKDSSNNTFVAATKSGLLHIIKKGEDKKLIKLAS
LGLKAPVEFLQLYDLEDTDTDKYIFAYGGEENLIKLVEIDSSFQSLKQIWEAKNVKNDRL
DMRVPVWPMALRFLEPSPGKTEKGKLNYQFAAITRWSHLTKYSTQHGRKPFAQIDLLPNR
EPLSQMEVFDAKGENVVSSLGNFQSETFNELNVITTDYKKNVFKFDGNGRMLGKVGRDDI
TGSSTYIHVHDGKYLLQGGLDRYVRIFDIKTNKMLVKVYVGSRINFIVMLDDVEIEMPLS
PSAKAAKGKQKRKVTELEEDADELWNKLEGKVAASKASKKSKI

Primary citation

Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes. Kater, L., Thoms, M., Barrio-Garcia, C. et al. Cell (2017) 171:1599-1610.e14. DOI 10.1016/j.cell.2017.11.039 · PubMed

Other PDB entries of the same protein (UniProt P53136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SUI 1.3 Å, Ribosome assembly factor NSA1: C-terminal truncation
8V83 2.53 Å, 60S ribosome biogenesis intermediate (Dbp10 pre-catalytic structure - Overall map)
8V84 2.7 Å, 60S ribosome biogenesis intermediate (Dbp10 catalytic structure - Overall map)
5SUM 2.8 Å, Ribosome assembly factor NSA1
6EM3 3.2 Å, State A architectural model (Nsa1-TAP Flag-Ytm1) - Visualizing the assembly pathway of…
7OHX 3.3 Å, Nog1-TAP associated immature ribosomal particles from S. cerevisiae after rpL34…
7OHW 3.5 Å, Nog1-TAP associated immature ribosomal particles from S. cerevisiae after rpL25…
6EM1 3.6 Å, State C (Nsa1-TAP Flag-Ytm1) - Visualizing the assembly pathway of nucleolar pre-60S…
5Z3G 3.65 Å, Cryo-EM structure of a nucleolar pre-60S ribosome (Rpf1-TAP)
6C0F 3.7 Å, Yeast nucleolar pre-60S ribosomal subunit (state 2)
6EM4 4.1 Å, State B architectural model (Nsa1-TAP Flag-Ytm1) - Visualizing the assembly pathway of…
6EM5 4.3 Å, State D architectural model (Nsa1-TAP Flag-Ytm1) - Visualizing the assembly pathway of…

Browse structure collections

About this viewer

MolViewer shows 6EN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.