Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP. Determined by X-ray diffraction at 2.38 Å resolution. Released 20 Dec 2017.
Explore 6EQL in 3D Show helices and sheets RCSB PDB PDBe
6EQL contains 32 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-28 | 16 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 45-54 | 10 | |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 71-76 | 6 | |
| α-helix | 78-80 | 3 | |
| α-helix | 81-87 | 7 | |
| α-helix | 88-91 | 4 | |
| β-strand | 97-101 | 5 | 1 |
| β-strand | 105-107 | 3 | 2 |
| α-helix | 112-116 | 5 | |
| β-strand | 121-124 | 4 | 1 |
| α-helix | 125 | 1 | |
| β-strand | 132-139 | 8 | 1 |
| α-helix | 143-156 | 14 | |
| α-helix | 164-170 | 7 | |
| α-helix | 179-181 | 3 | |
| β-strand | 182 | 1 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 189 | 1 | 2 |
| α-helix | 199-202 | 4 | |
| α-helix | 204-207 | 4 | |
| β-strand | 210-212 | 3 | 2 |
| α-helix | 219-221 | 3 | |
| β-strand | 225 | 1 | 3 |
| β-strand | 230 | 1 | 3 |
| α-helix | 244-252 | 9 | |
| α-helix | 253-257 | 5 | |
| α-helix | 258-260 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 4 |
| α-helix | 13-28 | 16 | |
| β-strand | 34-39 | 6 | 4 |
| α-helix | 45-54 | 10 | |
| β-strand | 57-60 | 4 | 4 |
| α-helix | 71-76 | 6 | |
| α-helix | 81-86 | 6 | |
| α-helix | 87-91 | 5 | |
| β-strand | 97-101 | 5 | 4 |
| β-strand | 105-107 | 3 | 5 |
| α-helix | 112-116 | 5 | |
| β-strand | 121-124 | 4 | 4 |
| α-helix | 125 | 1 | |
| β-strand | 132-139 | 8 | 4 |
| α-helix | 143-156 | 14 | |
| α-helix | 159-161 | 3 | |
| α-helix | 164-170 | 7 | |
| α-helix | 179-181 | 3 | |
| β-strand | 182 | 1 | 4 |
| α-helix | 185-187 | 3 | |
| β-strand | 189 | 1 | 5 |
| β-strand | 210-212 | 3 | 5 |
| α-helix | 219-221 | 3 | |
| α-helix | 244-256 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogenin-1 | A, B | protein | 263 | Homo sapiens | P46976 (AlphaFold model) |
>6EQL_1 Glycogenin-1 (chains A, B) SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVI MVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREE LSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDI RKHLPFIYNLSSISIFSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPN MTHPEFLILWWNIFTTNVLPLLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| UDP | Uridine-5'-diphosphate | C9 H14 N2 O12 P2 | 2 |
| 2PE | Nonaethylene glycol | C18 H38 O10 | 1 |
| MN | Manganese (II) ion | Mn | 2 |
Water and common crystallization additives (EDO) are not listed.
Palladium-mediated enzyme activation suggests multiphase initiation of glycogenesis. Bilyard, M.K., Bailey, H.J., Raich, L. et al. Nature (2018) 563:235-240. DOI 10.1038/s41586-018-0644-7 · PubMed
Other PDB entries of the same protein (UniProt P46976 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6EQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.