Botulinum neurotoxin A3 Hc domain. Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Jan 2018.
Explore 6F0O in 3D Show helices and sheets RCSB PDB PDBe
6F0O contains 6 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 873-876 | 4 | 1 |
| β-strand | 877-880 | 4 | 2 |
| β-strand | 883-886 | 4 | 2 |
| β-strand | 893-896 | 4 | 3 |
| β-strand | 900-902 | 3 | 1 |
| β-strand | 910-913 | 4 | 1 |
| β-strand | 920-923 | 4 | 3 |
| α-helix | 926-928 | 3 | |
| β-strand | 931-932 | 2 | 4 |
| β-strand | 937-944 | 8 | 1 |
| α-helix | 946-948 | 3 | |
| α-helix | 951-953 | 3 | |
| β-strand | 958-965 | 8 | 3 |
| β-strand | 968-975 | 8 | 3 |
| β-strand | 978-984 | 7 | 3 |
| β-strand | 990-996 | 7 | 3 |
| β-strand | 1011-1017 | 7 | 1 |
| β-strand | 1022-1027 | 6 | 1 |
| β-strand | 1030-1036 | 7 | 1 |
| β-strand | 1043-1044 | 2 | 4 |
| β-strand | 1045-1054 | 10 | 3 |
| β-strand | 1062-1071 | 10 | 1 |
| α-helix | 1077-1087 | 11 | |
| β-strand | 1092 | 1 | 5 |
| β-strand | 1094 | 1 | 6 |
| β-strand | 1100 | 1 | 6 |
| α-helix | 1101 | 1 | |
| β-strand | 1102 | 1 | 7 |
| β-strand | 1107-1111 | 5 | 8 |
| β-strand | 1118-1122 | 5 | 8 |
| β-strand | 1129-1133 | 5 | 8 |
| β-strand | 1138-1141 | 4 | 9 |
| β-strand | 1145-1148 | 4 | 9 |
| β-strand | 1155-1160 | 6 | 8 |
| β-strand | 1169 | 1 | 7 |
| β-strand | 1171 | 1 | 5 |
| β-strand | 1175-1182 | 8 | 8 |
| β-strand | 1185-1190 | 6 | 8 |
| β-strand | 1191 | 1 | 10 |
| β-strand | 1200-1201 | 2 | 8 |
| β-strand | 1203-1205 | 3 | 8 |
| α-helix | 1207-1209 | 3 | |
| β-strand | 1214 | 1 | 10 |
| β-strand | 1216-1222 | 7 | 8 |
| β-strand | 1228-1236 | 9 | 8 |
| β-strand | 1242-1251 | 10 | 8 |
| β-strand | 1254-1260 | 7 | 8 |
| β-strand | 1278-1281 | 4 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bontoxilysin A | A | protein | 433 | Clostridium botulinum (strain Loch Maree / Type A3) | Q45894 (AlphaFold model) |
>6F0O_1 Bontoxilysin A (chains A) MHHHHHHKNIVNTSILSIVYKKDDLIDLSRYGAKINIGDRVYYDSIDKNQIKLINLESST IEVILKNAIVYNSMYENFSTSFWIKIPKYFSKINLNNEYTIINCIENNSGWKVSLNYGEI IWTLQDNKQNIQRVVFKYSQMVNISDYINRWMFVTITNNRLTKSKIYINGRLIDQKPISN LGNIHASNKIMFKLDGCRDPRRYIMIKYFNLFDKELNEKEIKDLYDSQSNPGILKDFWGN YLQYDKPYYMLNLFDPNKYVDVNNIGIRGYMYLKGPRGSVMTTNIYLNSTLYMGTKFIIK KYASGNEDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVM KSKDDQGIRNKCKMNLQDNNGNDIGFVGFHLYDNIAKLVASNWYNRQVGKASRTFGCSWE FIPVDDGWGESSL
| ID | Name | Formula | Copies |
|---|---|---|---|
| PPI | Propanoic acid | C3 H6 O2 | 1 |
Water and common crystallization additives (EDO, 1PE) are not listed.
High resolution crystal structures of Clostridium botulinum neurotoxin A3 and A4 binding domains. Davies, J.R., Rees, J., Liu, S.M. et al. J Struct Biol (2018) 202:113-117. DOI 10.1016/j.jsb.2017.12.010 · PubMed
Other PDB entries of the same protein (UniProt Q45894 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.