6F3T: Human TAF5-TAF6-TAF9 complex

Name: PDB 6F3T: Crystal structure of the human TAF5-TAF6-TAF9 complex
Published: 2018-12-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the human TAF5-TAF6-TAF9 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Dec 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 12
Atoms: 24,768
Mol. weight: 372.91 kDa
Released: 5 Dec 2018

Explore 6F3T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F3T contains 153 α-helices and 148 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
α-helix	214-226	13
α-helix	230-236	7
α-helix	237-239	3
α-helix	240-253	14
α-helix	257-267	11
α-helix	268-270	3
α-helix	273-275	3
α-helix	276-284	9
α-helix	288-292	5
α-helix	295-302	8
α-helix	304	1
β-strand	305-310	6	1
α-helix	311-321	11
α-helix	324-326	3
α-helix	327-336	10
β-strand	337-342	6	1
α-helix	346-348	3
α-helix	349-355	7
β-strand	361	1	1
α-helix	365-368	4
α-helix	376-379	4
α-helix	422-423	2
α-helix	430-433	4
α-helix	434-447	14
β-strand	454	1	2
β-strand	457	1	2
α-helix	458-459	2
β-strand	460-465	6	3
α-helix	466-469	4
β-strand	473-478	6	4
β-strand	484-489	6	4
β-strand	494-498	5	4
α-helix	510-513	4
α-helix	514-517	4
α-helix	522-527	6
β-strand	534-539	6	4
β-strand	546-551	6	5
β-strand	557-562	6	5
β-strand	566-571	6	5
β-strand	577-582	6	5
β-strand	588-593	6	6
β-strand	599-604	6	6
β-strand	608-613	6	6
β-strand	621-624	4	6
β-strand	630-635	6	7
β-strand	641-646	6	7
β-strand	650-655	6	7
β-strand	661-666	6	7
β-strand	672-677	6	8
β-strand	683-688	6	8
β-strand	693-697	5	8
β-strand	702-707	6	8
β-strand	714-719	6	9
β-strand	725-730	6	9
β-strand	734-739	6	9
α-helix	740-743	4
α-helix	765-768	4
β-strand	769-774	6	9
β-strand	780-785	6	3
β-strand	790-795	6	3

Chain B: 28 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
α-helix	214-226	13
α-helix	230-236	7
α-helix	237-239	3
α-helix	240-253	14
α-helix	257-267	11
α-helix	268-270	3
α-helix	273-275	3
α-helix	276-284	9
α-helix	288-292	5
α-helix	295-302	8
α-helix	304	1
β-strand	305-310	6	10
α-helix	311-321	11
α-helix	327-336	10
β-strand	337-342	6	10
α-helix	346-348	3
α-helix	349-355	7
β-strand	361	1	10
α-helix	365-368	4
α-helix	376-379	4
α-helix	422-423	2
α-helix	430-433	4
α-helix	434-448	15
α-helix	450-453	4
β-strand	454	1	11
β-strand	457	1	11
α-helix	458-460	3
β-strand	461-465	5	12
α-helix	466-469	4
β-strand	473-478	6	13
β-strand	484-489	6	13
β-strand	494-498	5	13
α-helix	510-516	7
α-helix	522-527	6
β-strand	534-539	6	13
β-strand	546-551	6	14
β-strand	557-562	6	14
β-strand	566-571	6	14
β-strand	577-582	6	14
β-strand	588-593	6	15
β-strand	599-604	6	15
β-strand	608-613	6	15
β-strand	621-624	4	15
β-strand	630-635	6	16
β-strand	641-646	6	16
β-strand	650-655	6	16
β-strand	661-666	6	16
β-strand	672-677	6	17
β-strand	683-688	6	17
β-strand	693-697	5	17
β-strand	702-707	6	17
β-strand	714-719	6	18
β-strand	725-730	6	18
β-strand	734-739	6	18
α-helix	740-743	4
α-helix	765-768	4
β-strand	769-774	6	18
β-strand	780-785	6	12
β-strand	791-795	5	12

Chain C: 29 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
α-helix	214-226	13
α-helix	230-236	7
α-helix	237-239	3
α-helix	240-253	14
α-helix	257-267	11
α-helix	268-270	3
α-helix	273-275	3
α-helix	276-284	9
α-helix	288-292	5
α-helix	295-302	8
α-helix	304	1
β-strand	305-310	6	19
α-helix	311-321	11
α-helix	324-326	3
α-helix	327-336	10
β-strand	337-342	6	19
α-helix	346-348	3
α-helix	349-355	7
β-strand	361	1	19
α-helix	365-368	4
α-helix	376-379	4
α-helix	422-423	2
α-helix	430-433	4
α-helix	434-448	15
α-helix	450-453	4
β-strand	454	1	20
β-strand	457	1	20
α-helix	458-460	3
β-strand	461-465	5	21
α-helix	466-469	4
β-strand	473-478	6	22
β-strand	484-489	6	22
β-strand	494-498	5	22
α-helix	510-517	8
α-helix	522-527	6
β-strand	534-539	6	22
β-strand	546-551	6	23
β-strand	557-562	6	23
β-strand	566-571	6	23
β-strand	577-582	6	23
β-strand	588-593	6	24
β-strand	599-604	6	24
β-strand	608-613	6	24
β-strand	621-624	4	24
β-strand	630-635	6	25
β-strand	641-646	6	25
β-strand	650-655	6	25
β-strand	661-666	6	25
β-strand	672-677	6	26
β-strand	683-688	6	26
β-strand	693-697	5	26
β-strand	702-707	6	26
β-strand	714-719	6	27
β-strand	725-730	6	27
β-strand	734-739	6	27
α-helix	740-743	4
α-helix	765-768	4
β-strand	769-774	6	27
β-strand	780-785	6	21
β-strand	791-795	5	21

Chain D: 29 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	211-213	3
α-helix	214-227	14
α-helix	230-236	7
α-helix	237-239	3
α-helix	240-253	14
α-helix	257-267	11
α-helix	268-270	3
α-helix	273-275	3
α-helix	276-284	9
α-helix	288-292	5
α-helix	295-302	8
α-helix	304	1
β-strand	305-310	6	28
α-helix	311-322	12
α-helix	324-326	3
α-helix	327-336	10
β-strand	337-342	6	28
α-helix	345-348	4
α-helix	349-355	7
β-strand	361	1	28
α-helix	365-368	4
α-helix	376-379	4
α-helix	422-423	2
α-helix	430-433	4
α-helix	434-448	15
α-helix	450-453	4
β-strand	454	1	29
β-strand	457	1	29
α-helix	458-460	3
β-strand	461-465	5	30
α-helix	466-469	4
β-strand	473-478	6	31
β-strand	484-489	6	31
β-strand	494-498	5	31
α-helix	510-516	7
α-helix	522-527	6
β-strand	534-539	6	31
β-strand	546-551	6	32
β-strand	557-562	6	32
β-strand	566-571	6	32
β-strand	577-582	6	32
β-strand	588-593	6	33
β-strand	599-604	6	33
β-strand	608-613	6	33
β-strand	621-624	4	33
β-strand	630-635	6	34
β-strand	641-646	6	34
β-strand	650-655	6	34
β-strand	661-666	6	34
β-strand	672-677	6	35
β-strand	683-688	6	35
β-strand	693-697	5	35
β-strand	702-707	6	35
β-strand	714-719	6	36
β-strand	725-730	6	36
β-strand	734-739	6	36
α-helix	740-743	4
α-helix	765-768	4
β-strand	769-774	6	36
β-strand	780-785	6	30
β-strand	791-795	5	30

Chains E and K: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	16-24	9
α-helix	33-60	28
β-strand	66	1	37
α-helix	68-78	11
β-strand	85-87	3	31
β-strand	92-93	2	30
β-strand	96	1	36

Chains F and J: 6 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-10	2
α-helix	16-25	10
β-strand	31	1	37
α-helix	34-60	27
α-helix	68-81	14
α-helix	89-100	12
α-helix	103-106	4

Chain G: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	16-25	10
α-helix	33-60	28
β-strand	66	1	38
α-helix	68-77	10
β-strand	85-87	3	22
β-strand	92-93	2	21
β-strand	96	1	27

Chains H and L: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-10	2
α-helix	13-15	3
α-helix	16-25	10
β-strand	31	1	38
α-helix	34-60	27
α-helix	68-81	14
α-helix	89-100	12
α-helix	103-106	4

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 5	A, B, C, D	protein	608	Homo sapiens	Q15542 (AlphaFold model)
Transcription initiation factor TFIID subunit 6	E, G, I, K	protein	94	Homo sapiens	P49848 (AlphaFold model)
Transcription initiation factor TFIID subunit 9	F, H, J, L	protein	116	Homo sapiens	Q16594 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6F3T_1 Transcription initiation factor TFIID subunit 5 (chains A, B, C, D)
GDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELV
YNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRD
SYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKV
FFGLLKEPEIEVPLDDEDEEGENEEGKSKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPEL
KDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADS
TVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFS
PDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLW
ATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPI
HSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMD
NTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVL
AAGAYSPQ

Sequence of entity 2 (E, G, I, K), FASTA

>6F3T_2 Transcription initiation factor TFIID subunit 6 (chains E, G, I, K)
KKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQ
KLTTSDIDYALKLKNVEPLYGFHAQEFIRLRRRA

Sequence of entity 3 (F, H, J, L), FASTA

>6F3T_3 Transcription initiation factor TFIID subunit 9 (chains F, H, J, L)
KTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKA
TVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY

Primary citation

Chaperonin CCT checkpoint function in basal transcription factor TFIID assembly. Antonova, S.V., Haffke, M., Corradini, E. et al. Nat Struct Mol Biol (2018) 25:1119-1127. DOI 10.1038/s41594-018-0156-z · PubMed

Other PDB entries of the same protein (UniProt Q15542 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NXP 2.17 Å, Structure of NTD2 domain of the human TAF5 subunit of TFIID
7EGG 2.77 Å, TFIID lobe B subcomplex
7EGF 3.16 Å, TFIID lobe A subcomplex
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
7EG9 3.7 Å, TFIID-based intermediate PIC on SCP promoter
7EGC 3.9 Å, p53-bound TFIID-based holo PIC on HDM2 promoter
7ENA 4.07 Å, TFIID-based PIC-Mediator holo-complex in pre-assembled state (pre-hPIC-MED)
7EGA 4.1 Å, TFIID-based intermediate PIC on PUMA promoter
7ENC 4.13 Å, TFIID-based PIC-Mediator holo-complex in fully-assembled state (hPIC-MED)
8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
6MZC 4.5 Å, Human TFIID BC core
7EDX 4.5 Å, p53-bound TFIID-based core PIC on HDM2 promoter

Browse structure collections

About this viewer

MolViewer shows 6F3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.