6F6P: Tetrameric human Rabin8 GEF domain

Crystal structure of tetrameric human Rabin8 GEF domain. Determined by X-ray diffraction at 2.45 Å resolution. Released 13 Dec 2017.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,172
Mol. weight: 47.99 kDa
Released: 13 Dec 2017

Explore 6F6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F6P contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	149-244	96

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	150-243	94

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	156-242	87

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	150-244	95

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rab-3A-interacting protein	A, B, D	protein	106	Homo sapiens	Q96QF0 (AlphaFold model)
Rab-3A-interacting protein	C	protein	106	Homo sapiens	Q96QF0 (AlphaFold model)

Sequence of entity 1 (A, B, D), FASTA

>6F6P_1 Rab-3A-interacting protein (chains A, B, D)
GAASRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTAS
LFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLS

Sequence of entity 2 (C), FASTA

>6F6P_2 Rab-3A-interacting protein (chains C)
GASSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTAS
LFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLS

Primary citation

Crystal structure of tetrameric human Rabin8 GEF domain. Vetter, M., Boegholm, N., Christensen, A. et al. Proteins (2018) 86:405-413. DOI 10.1002/prot.25455 · PubMed

Other PDB entries of the same protein (UniProt Q96QF0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UJ5 2.6 Å, Crystal structure of human Rab11-Rabin8-FIP3
4UJ3 3.0 Å, Crystal structure of human Rab11-Rabin8-FIP3
4LHX 3.05 Å, Crystal structure of nucleotide-free Rab8:Rabin8
4LHY 3.1 Å, Crystal structure of GDP-bound Rab8:Rabin8
4LHZ 3.2 Å, Crystal structure of GTP-bound Rab8:Rabin8
4UJ4 4.2 Å, Crystal structure of human Rab11-Rabin8-FIP3

Browse structure collections

About this viewer

MolViewer shows 6F6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.