Crystal structure of Human ARS2 residues 147-270 + 408-763. Determined by X-ray diffraction at 3.7 Å resolution. Released 9 May 2018.
Explore 6F7P in 3D Show helices and sheets RCSB PDB PDBe
6F7P contains 56 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 152-157 | 6 | |
| α-helix | 165-190 | 26 | |
| α-helix | 195-201 | 7 | |
| α-helix | 203-230 | 28 | |
| β-strand | 239 | 1 | 1 |
| α-helix | 243-258 | 16 | |
| α-helix | 262-265 | 4 | |
| α-helix | 266-268 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 149-151 | 3 | |
| α-helix | 152-157 | 6 | |
| α-helix | 165-190 | 26 | |
| α-helix | 195-201 | 7 | |
| α-helix | 203-230 | 28 | |
| β-strand | 239 | 1 | 9 |
| α-helix | 243-258 | 16 | |
| α-helix | 262-265 | 4 | |
| α-helix | 266-268 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 421-427 | 7 | 2 |
| α-helix | 433-441 | 9 | |
| β-strand | 446-451 | 6 | 2 |
| α-helix | 453-454 | 2 | |
| β-strand | 455 | 1 | 3 |
| α-helix | 456-458 | 3 | |
| β-strand | 461 | 1 | 3 |
| β-strand | 462-468 | 7 | 2 |
| α-helix | 475-480 | 6 | |
| β-strand | 485-486 | 2 | 4 |
| β-strand | 489-490 | 2 | 4 |
| β-strand | 494-496 | 3 | 2 |
| α-helix | 497-499 | 3 | |
| β-strand | 503-505 | 3 | 5 |
| α-helix | 508-510 | 3 | |
| α-helix | 513-534 | 22 | |
| α-helix | 555-562 | 8 | |
| α-helix | 570-575 | 6 | |
| α-helix | 602-617 | 16 | |
| β-strand | 621-622 | 2 | 6 |
| β-strand | 627-628 | 2 | 6 |
| β-strand | 642-644 | 3 | 5 |
| β-strand | 645 | 1 | 1 |
| α-helix | 652-654 | 3 | |
| α-helix | 657-669 | 13 | |
| α-helix | 670-673 | 4 | |
| α-helix | 674-676 | 3 | |
| β-strand | 678 | 1 | 7 |
| α-helix | 679-680 | 2 | |
| α-helix | 681-687 | 7 | |
| α-helix | 689-691 | 3 | |
| α-helix | 692-703 | 12 | |
| β-strand | 705-708 | 4 | 8 |
| β-strand | 711-714 | 4 | 8 |
| β-strand | 719-721 | 3 | 8 |
| α-helix | 724-734 | 11 | |
| α-helix | 736-754 | 19 | |
| β-strand | 755 | 1 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 421-427 | 7 | 10 |
| α-helix | 433-441 | 9 | |
| β-strand | 446-451 | 6 | 10 |
| α-helix | 453-454 | 2 | |
| β-strand | 455 | 1 | 11 |
| α-helix | 456-458 | 3 | |
| β-strand | 461 | 1 | 11 |
| β-strand | 462-468 | 7 | 10 |
| α-helix | 475-480 | 6 | |
| β-strand | 485-486 | 2 | 12 |
| β-strand | 489-490 | 2 | 12 |
| β-strand | 494-496 | 3 | 10 |
| α-helix | 497-499 | 3 | |
| β-strand | 503-505 | 3 | 13 |
| α-helix | 508-510 | 3 | |
| α-helix | 513-534 | 22 | |
| α-helix | 555-557 | 3 | |
| α-helix | 561-564 | 4 | |
| α-helix | 570-576 | 7 | |
| α-helix | 602-617 | 16 | |
| β-strand | 621-622 | 2 | 14 |
| β-strand | 627-628 | 2 | 14 |
| β-strand | 642-644 | 3 | 13 |
| β-strand | 645 | 1 | 9 |
| α-helix | 652-654 | 3 | |
| α-helix | 657-669 | 13 | |
| α-helix | 670-673 | 4 | |
| α-helix | 674-676 | 3 | |
| β-strand | 678 | 1 | 15 |
| α-helix | 679-680 | 2 | |
| α-helix | 681-687 | 7 | |
| α-helix | 689-691 | 3 | |
| α-helix | 692-703 | 12 | |
| β-strand | 705-708 | 4 | 16 |
| β-strand | 711-714 | 4 | 16 |
| β-strand | 719-721 | 3 | 16 |
| α-helix | 724-734 | 11 | |
| α-helix | 736-754 | 19 | |
| β-strand | 755 | 1 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serrate RNA effector molecule homolog | A, B | protein | 124 | Homo sapiens | Q9BXP5 (AlphaFold model) |
| Serrate RNA effector molecule homolog | C, D | protein | 356 | Homo sapiens | Q9BXP5 (AlphaFold model) |
>6F7P_1 Serrate RNA effector molecule homolog (chains A, B) PVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEV GKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLR ILEQ
>6F7P_2 Serrate RNA effector molecule homolog (chains C, D) GLECKPRPLHKTCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVT FDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQIVRNDIKLAAKLI HTLDDRTQLWASEPGTPPLPTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEP PKEGNPAEINVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRGP MPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEVEKFVTSNTQEL GKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPE
Structural analysis of human ARS2 as a platform for co-transcriptional RNA sorting. Schulze, W.M., Stein, F., Rettel, M. et al. Nat Commun (2018) 9:1701-1701. DOI 10.1038/s41467-018-04142-7 · PubMed
Other PDB entries of the same protein (UniProt Q9BXP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F7P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.