6F8F: Speckle-type POZ protein

Co-crystal structure of SPOP MATH domain and human Pdx1 fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Nov 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,191
Mol. weight: 17.75 kDa
Released: 28 Nov 2018

Explore 6F8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F8F contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-38	9	1
α-helix	41-43	3
α-helix	44-48	5
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57	1	2
β-strand	67-72	6	2
β-strand	83-90	8	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	1

Chain G: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	229-230	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	D	protein	145	Homo sapiens	O43791 (AlphaFold model)
Pancreas/duodenum homeobox protein 1	G	protein	11	Homo sapiens	P52945 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6F8F_1 Speckle-type POZ protein (chains D)
GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (G), FASTA

>6F8F_2 Pancreas/duodenum homeobox protein 1 (chains G)
PEQDCAVTSGE

Primary citation

The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation. Ostertag, M.S., Messias, A.C., Sattler, M. et al. Structure (2019) 27:327-334.e3. DOI 10.1016/j.str.2018.10.005 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment

Browse structure collections

About this viewer

MolViewer shows 6F8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.