Co-crystal structure of SPOP MATH domain and human Pdx1 fragment. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Nov 2018.
Explore 6F8F in 3D Show helices and sheets RCSB PDB PDBe
6F8F contains 6 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-38 | 9 | 1 |
| α-helix | 41-43 | 3 | |
| α-helix | 44-48 | 5 | |
| β-strand | 52-53 | 2 | 2 |
| α-helix | 54-56 | 3 | |
| β-strand | 57 | 1 | 2 |
| β-strand | 67-72 | 6 | 2 |
| β-strand | 83-90 | 8 | 2 |
| β-strand | 98-107 | 10 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 123-125 | 3 | 1 |
| β-strand | 130-138 | 9 | 2 |
| α-helix | 139-143 | 5 | |
| α-helix | 145-147 | 3 | |
| α-helix | 151-153 | 3 | |
| β-strand | 155-163 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 229-230 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Speckle-type POZ protein | D | protein | 145 | Homo sapiens | O43791 (AlphaFold model) |
| Pancreas/duodenum homeobox protein 1 | G | protein | 11 | Homo sapiens | P52945 (AlphaFold model) |
>6F8F_1 Speckle-type POZ protein (chains D) GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDF LLDEANGLLPDDKLTLFCEVSVVQD
>6F8F_2 Pancreas/duodenum homeobox protein 1 (chains G) PEQDCAVTSGE
The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation. Ostertag, M.S., Messias, A.C., Sattler, M. et al. Structure (2019) 27:327-334.e3. DOI 10.1016/j.str.2018.10.005 · PubMed
Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.