6FDY: Unc-51-Like Kinase 3

Unc-51-Like Kinase 3 (ULK3) In Complex With Bosutinib. Determined by X-ray diffraction at 1.7 Å resolution. Released 1 Aug 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,247
Mol. weight: 33 kDa
Ligands: DB8
Released: 1 Aug 2018

Explore 6FDY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FDY contains 13 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain U: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	1
β-strand	28-33	6	1
β-strand	36-47	12	1
α-helix	48-50	3
α-helix	53-67	15
β-strand	74	1	2
β-strand	77-82	6	1
β-strand	86-92	7	1
β-strand	98	1	2
α-helix	99-106	8
α-helix	111-130	20
β-strand	133-134	2	3
α-helix	140-142	3
β-strand	143-145	3	2
α-helix	151-152	2
β-strand	153-155	3	2
β-strand	162-163	2	3
β-strand	170	1	4
α-helix	182-186	5
β-strand	190	1	4
α-helix	194-208	15
α-helix	218-226	9
α-helix	229-231	3
α-helix	241-250	10
α-helix	259-260	2
α-helix	261-265	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase ULK3	U	protein	276	Homo sapiens	Q6PHR2 (AlphaFold model)

Sequence of entity 1 (U), FASTA

>6FDY_1 Serine/threonine-protein kinase ULK3 (chains U)
AGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLT
EIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQL
ASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMA
PEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPLLSR
DCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPS

Ligands and cofactors

ID	Name	Formula	Copies
DB8	4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-1-yl)…	C26 H29 Cl2 N5 O3	2

Primary citation

Unc-51-Like Kinase 3 (ULK3) In Complex With Bosutinib. Mathea, S., Salah, E., Moroglu, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q6PHR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WZX 1.39 Å, ULK3 regulates cytokinetic abscission by phosphorylating ESCRT-III proteins
6FDZ 2.55 Å, Unc-51-Like Kinase 3 (ULK3) In Complex With Momelotinib

Browse structure collections

About this viewer

MolViewer shows 6FDY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.